KEGG   Homo sapiens (human): 1522
Entry
1522              CDS       T01001                                 

Gene name
CTSZ, CTSX
Definition
(RefSeq) cathepsin Z
  KO
K08568  cathepsin X [EC:3.4.18.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04142  Lysosome
hsa04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    1522 (CTSZ)
  09143 Cell growth and death
   04210 Apoptosis
    1522 (CTSZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    1522 (CTSZ)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.18  Cysteine-type carboxypeptidases
    3.4.18.1  cathepsin X
     1522 (CTSZ)
Peptidases and inhibitors [BR:hsa01002]
 Cysteine peptidases
  Family C1: papain family
   1522 (CTSZ)
SSDB
Motif
Pfam: Peptidase_C1 Peptidase_C1_2
Other DBs
NCBI-GeneID: 1522
NCBI-ProteinID: NP_001327
OMIM: 603169
HGNC: 2547
Ensembl: ENSG00000101160
Vega: OTTHUMG00000032858
Pharos: Q9UBR2(Tchem)
UniProt: Q9UBR2
Structure
PDB: 
1DEU 1EF7

Position
20q13.32
AA seq 303 aa
MARRGPGWRPLLLLVLLAGAAQGGLYFRRGQTCYRPLRGDGLAPLGRSTYPRPHEYLSPA
DLPKSWDWRNVDGVNYASITRNQHIPQYCGSCWAHASTSAMADRINIKRKGAWPSTLLSV
QNVIDCGNAGSCEGGNDLSVWDYAHQHGIPDETCNNYQAKDQECDKFNQCGTCNEFKECH
AIRNYTLWRVGDYGSLSGREKMMAEIYANGPISCGIMATERLANYTGGIYAEYQDTTYIN
HVVSVAGWGISDGTEYWIVRNSWGEPWGERGWLRIVTSTYKDGKGARYNLAIEEHCTFGD
PIV
NT seq 912 nt   +upstreamnt  +downstreamnt
atggcgaggcgcgggccagggtggcggccgcttctgctgctcgtgctgctggcgggcgcg
gcgcagggcggcctctacttccgccggggacagacctgctaccggcctctgcggggggac
gggctggctccgctggggcgcagcacatacccccggcctcatgagtacctgtccccagcg
gatctgcccaagagctgggactggcgcaatgtggatggtgtcaactatgccagcatcacc
cggaaccagcacatcccccaatactgcggctcctgctgggcccacgccagcaccagcgct
atggcggatcggatcaacatcaagaggaagggagcgtggccctccaccctcctgtccgtg
cagaacgtcatcgactgcggtaacgctggctcctgtgaagggggtaatgacctgtccgtg
tgggactacgcccaccagcacggcatccctgacgagacctgcaacaactaccaggccaag
gaccaggagtgtgacaagtttaaccaatgtgggacatgcaatgaattcaaagagtgccac
gccatccggaactacaccctctggagggtgggagactacggctccctctctgggagggag
aagatgatggcagaaatctatgcaaatggtcccatcagctgtggaataatggcaacagaa
agactggctaactacaccggaggcatctatgccgaataccaggacaccacatatataaac
catgtcgtttctgtggctgggtggggcatcagtgatgggactgagtactggattgtccgg
aattcatggggtgaaccatggggcgagagaggctggctgaggatcgtgaccagcacctat
aaggatgggaagggcgccagatacaaccttgccatcgaggagcactgtacatttggggac
cccatcgtttaa

DBGET integrated database retrieval system