KEGG   Homo sapiens (human): 152330Help
Entry
152330            CDS       T01001                                 

Gene name
CNTN4, AXCAM, BIG-2
Definition
(RefSeq) contactin 4
  KO
K06762  contactin 4
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:hsa04515]
    152330 (CNTN4)
Cell adhesion molecules [BR:hsa04515]
 Immunoglobulin superfamily
  Contactins
   152330 (CNTN4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_3 I-set Ig_2 ig fn3 V-set Ig_6 Ig_5 Ig_C17orf99 Ig_4 C2-set_2 Adeno_E3_CR1 Tissue_fac
Motif
Other DBs
NCBI-GeneID: 152330
NCBI-ProteinID: NP_001193884
OMIM: 607280
HGNC: 2174
Ensembl: ENSG00000144619
Vega: OTTHUMG00000119031
Pharos: Q8IWV2(Tbio)
UniProt: Q8IWV2 A0A024R2E5
Position
3p26.3-p26.2
AA seq 1026 aa AA seqDB search
MRLPWELLVLQSFILCLADDSTLHGPIFIQEPSPVMFPLDSEEKKVKLNCEVKGNPKPHI
RWKLNGTDVDTGMDFRYSVVEGSLLINNPNKTQDAGTYQCTATNSFGTIVSREAKLQFAY
LDNFKTRTRSTVSVRRGQGMVLLCGPPPHSGELSYAWIFNEYPSYQDNRRFVSQETGNLY
IAKVEKSDVGNYTCVVTNTVTNHKVLGPPTPLILRNDGVMGEYEPKIEVQFPETVPTAKG
ATVKLECFALGNPVPTIIWRRADGKPIARKARRHKSNGILEIPNFQQEDAGLYECVAENS
RGKNVARGQLTFYAQPNWIQKINDIHVAMEENVFWECKANGRPKPTYKWLKNGEPLLTRD
RIQIEQGTLNITIVNLSDAGMYQCLAENKHGVIFSNAELSVIAVGPDFSRTLLKRVTLVK
VGGEVVIECKPKASPKPVYTWKKGRDILKENERITISEDGNLRIINVTKSDAGSYTCIAT
NHFGTASSTGNLVVKDPTRVMVPPSSMDVTVGESIVLPCQVTHDHSLDIVFTWSFNGHLI
DFDRDGDHFERVGGQDSAGDLMIRNIQLKHAGKYVCMVQTSVDRLSAAADLIVRGPPGPP
EAVTIDEITDTTAQLSWRPGPDNHSPITMYVIQARTPFSVGWQAVSTVPELIDGKTFTAT
VVGLNPWVEYEFRTVAANVIGIGEPSRPSEKRRTEEALPEVTPANVSGGGGSKSELVITW
ETVPEELQNGRGFGYVVAFRPYGKMIWMLTVLASADASRYVFRNESVHPFSPFEVKVGVF
NNKGEGPFSPTTVVYSAEEEPTKPPASIFARSLSATDIEVFWASPLEKNRGRIQGYEVKY
WRHEDKEENARKIRTVGNQTSTKITNLKGSVLYHLAVKAYNSAGTGPSSATVNVTTRKPP
PSQPPGNIIWNSSDSKIILNWDQVKALDNESEVKGYKVLYRWNRQSSTSVIETNKTSVEL
SLPFDEDYIIEIKPFSDGGDGSSSEQIRIPKISNAYARGSGASTSNACTLSAISTIMISL
TARSSL
NT seq 3081 nt NT seq  +upstreamnt  +downstreamnt
atgaggttgccatgggaactgctggtactgcaatcattcattttgtgccttgcagatgat
tccacactgcatggcccgatttttattcaagaaccaagtcctgtaatgttccctttggat
tctgaggagaaaaaagtgaagctcaattgtgaagttaaaggaaatccaaaacctcatatc
aggtggaagttaaatggaacagatgttgacactggtatggatttccgctacagtgttgtt
gaagggagcttgttgatcaataaccccaataaaacccaagatgctggaacgtaccagtgc
acagcgacaaactcgtttggaacaattgttagcagagaagcaaagcttcagtttgcttat
cttgacaactttaaaacaagaacaagaagcactgtgtctgtccgtcgaggtcaaggaatg
gtgctactgtgtggcccgccaccccattctggagagctgagttatgcctggatcttcaat
gaatacccttcctatcaggataatcgccgctttgtttctcaagagactgggaatctgtat
attgccaaagtagaaaaatcagatgttgggaattatacctgtgtggttaccaataccgtg
acaaaccacaaggtcctggggccacctacaccactaatattgagaaatgatggagtgatg
ggtgaatatgagcccaaaatagaagtgcagttcccagaaacagttccgactgcaaaagga
gcaacggtgaagctggaatgctttgctttaggaaatccagtaccaactattatctggcga
agagctgatggaaagccaatagcaaggaaagccagaagacacaagtcaaatggaattctt
gagatccctaattttcagcaggaggatgctggtttatatgaatgtgtagctgaaaattcc
agagggaaaaatgtagcaaggggacagctaactttctatgctcaacctaattggattcaa
aaaataaatgatattcacgtggccatggaagaaaatgtcttttgggaatgtaaagcaaat
ggaaggcctaagcctacatacaagtggctaaaaaatggcgaacctctgctaactcgggat
agaattcaaattgagcaaggaacactcaacataacaatagtgaacctctcagatgctggc
atgtatcagtgtttggcagagaataaacatggagttatcttttccaacgcagagcttagt
gttatagctgtaggtccagatttttcaagaacactcttgaaaagagtaactcttgtcaaa
gtgggaggtgaagttgtcattgagtgtaagccaaaagcgtctccaaaacctgtttacacc
tggaagaaaggaagggatatattaaaagaaaatgaaagaattaccatttctgaagatgga
aacctcagaatcatcaacgttactaaatcagacgctgggagttatacctgtatagccact
aaccattttggaactgctagcagtactggaaacttggtagtgaaagatccaacaagggta
atggtacccccttccagtatggatgtcactgttggagagagtattgttttaccgtgccag
gtaacgcatgatcactcgctagacatcgtgtttacttggtcatttaatggacacctgata
gactttgacagagatggggaccactttgaaagagttggagggcaggattcagctggtgat
ttgatgatccgaaacatccaactgaagcatgctgggaaatatgtctgcatggtccaaaca
agtgtggacaggctatctgctgctgcagacctgattgtaagaggtcctccaggtccccca
gaggctgtgacaatagacgaaatcacagataccactgctcagctctcctggagacccggg
cctgacaaccacagccccatcaccatgtatgtcattcaagccaggactccattctccgtg
ggctggcaagcagtcagtacagtcccagaactcattgatgggaagacattcacagcgacc
gtggtgggtttgaacccttgggttgaatatgaattccgcacagttgcagccaacgtgatt
gggattggggagcccagccgcccctcagagaaacggagaacagaagaagctctccccgaa
gtcacaccagcgaatgtcagtggtggcggaggcagcaaatctgaactggttataacctgg
gagacggtccctgaggaattacagaatggtcgaggctttggttatgtggtggccttccgg
ccctacggtaaaatgatctggatgctgacagtgctggcctcagctgatgcctctagatac
gtgttcaggaatgagagcgtgcaccccttctctccctttgaggttaaagtaggtgtcttc
aacaacaaaggagaaggccctttcagtcccaccacggtggtgtattctgcagaagaagaa
cccaccaaaccaccagccagtatctttgccagaagtctttctgccacagatattgaagtt
ttctgggcctccccactggagaagaatagaggacgaatacaaggttatgaggttaaatat
tggagacatgaagacaaagaagaaaatgctagaaaaatacgaacagttggaaatcagaca
tcaacaaaaatcacgaacttaaaaggcagtgtgctgtatcacttagctgtcaaggcatat
aattctgctgggacaggcccctctagtgcaacagtcaatgtgacaacccgaaagccacca
ccaagtcaaccccccggaaacatcatatggaattcatcagactccaaaattatcctgaat
tgggatcaagtgaaggccctggataatgagtcggaagtaaaaggatacaaagtcttgtac
agatggaacagacaaagcagcacatctgtcattgaaacaaataaaacatcggtggagctt
tctttgcctttcgatgaagattatataatagaaattaagccattcagcgacggaggagat
ggcagcagcagtgaacaaattcgaattccaaagatatcaaatgcctacgcgagaggatct
ggggcttccacttcgaatgcatgtacgctgtcagccatcagtacaataatgatttccctc
acagctaggtccagtttatga

DBGET integrated database retrieval system