KEGG   Homo sapiens (human): 1525Help
Entry
1525              CDS       T01001                                 

Gene name
CXADR, CAR, CAR4/6, HCAR
Definition
(RefSeq) CXADR, Ig-like cell adhesion molecule
  KO
K06788  coxsackievirus and adenovirus receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cardiovascular diseases
   05416 Viral myocarditis
    1525 (CXADR)
Cell adhesion molecules [BR:hsa04515]
 Immunoglobulin superfamily
  CTX family
   1525 (CXADR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-set Ig_3 I-set ig Ig_2 V-set_CD47 Syndecan Herpes_gE C2-set EphA2_TM Izumo-Ig Shisa DUF1191 IncA FAM163 Tweety Lamp FixQ
Motif
Other DBs
NCBI-GeneID: 1525
NCBI-ProteinID: NP_001329
OMIM: 602621
HGNC: 2559
Ensembl: ENSG00000154639
Vega: OTTHUMG00000074508
Pharos: P78310(Tbio)
UniProt: P78310
Structure
PDB: 

Position
21q21.1
AA seq 365 aa AA seqDB search
MALLLCFVLLCGVVDFARSLSITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIEWLIS
PADNQKVDQVIILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQC
KVKKAPGVANKKIHLVVLVKPSGARCYVDGSEEIGSDFKIKCEPKEGSLPLQYEWQKLSD
SQKMPTSWLAEMTSSVISVKNASSEYSGTYSCTVRNRVGSDQCLLRLNVVPPSNKAGLIA
GAIIGTLLALALIGLIIFCCRKKRREEKYEKEVHHDIREDVPPPKSRTSTARSYIGSNHS
SLGSMSPSNMEGYSKTQYNQVPSEDFERTPQSPTLPPAKVAAPNLSRMGAIPVMIPAQSK
DGSIV
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcctgctgtgcttcgtgctcctgtgcggagtagtggatttcgccagaagtttg
agtatcactactcctgaagagatgattgaaaaagccaaaggggaaactgcctatctgcca
tgcaaatttacgcttagtcccgaagaccagggaccgctggacatcgagtggctgatatca
ccagctgataatcagaaggtggatcaagtgattattttatattctggagacaaaatttat
gatgactactatccagatctgaaaggccgagtacattttacgagtaatgatctcaaatct
ggtgatgcatcaataaatgtaacgaatttacaactgtcagatattggcacatatcagtgc
aaagtgaaaaaagctcctggtgttgcaaataagaagattcatctggtagttcttgttaag
ccttcaggtgcgagatgttacgttgatggatctgaagaaattggaagtgactttaagata
aaatgtgaaccaaaagaaggttcacttccattacagtatgagtggcaaaaattgtctgac
tcacagaaaatgcccacttcatggttagcagaaatgacttcatctgttatatctgtaaaa
aatgcctcttctgagtactctgggacatacagctgtacagtcagaaacagagtgggctct
gatcagtgcctgttgcgtctaaacgttgtccctccttcaaataaagctggactaattgca
ggagccattataggaactttgcttgctctagcgctcattggtcttatcatcttttgctgt
cgtaaaaagcgcagagaagaaaaatatgaaaaggaagttcatcacgatatcagggaagat
gtgccacctccaaagagccgtacgtccactgccagaagctacatcggcagtaatcattca
tccctggggtccatgtctccttccaacatggaaggatattccaagactcagtataaccaa
gtaccaagtgaagactttgaacgcactcctcagagtccgactctcccacctgctaaggta
gctgcccctaatctaagtcgaatgggtgcgattcctgtgatgattccagcacagagcaag
gatgggtctatagtatag

DBGET integrated database retrieval system