KEGG   Homo sapiens (human): 152518
Entry
152518            CDS       T01001                                 
Symbol
NFXL1, CDZFP, HOZFP, OZFP, URCC5
Name
(RefSeq) nuclear transcription factor, X-box binding like 1
  KO
K15683  NF-X1-type zinc finger protein NFXL1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    152518 (NFXL1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   NFX1 proteins
    152518 (NFXL1)
SSDB
Motif
Pfam: zf-NF-X1
Other DBs
NCBI-GeneID: 152518
NCBI-ProteinID: NP_001265552
OMIM: 620488
HGNC: 18726
Ensembl: ENSG00000170448
UniProt: Q6ZNB6 B1Q2B0
Position
4:complement(47847233..47914667)
AA seq 911 aa
MEASWRQVAGGRGRSRGRATAAPSGNGVHLRGAGGGREKGSVGAVPSGTSPGGVATTAAA
GSRHSPAGSQALQTTAASELMSQKKFEEIKKANQAAARKLVEEQFSSSSEEGDEDFEGKQ
GKILANTFITYTTQTDGDTRELERTKQYVNEAFQAGAMTCLICIASVKRNQAVWSCSGCF
CIFHMPCIQKWAKDSQFLVSSVTDDDFGKKDCPWPCPKCRFEYKRSETPSRYYCYCGKVE
DPPLDPWLVPHSCGQVCEREFKPPCGHKCLLLCHPGPCPPCPKMVTTTCYCKKAKPIPRR
CSAKEWSCQLPCGQKLLCGQHKCENPCHAGSCQPCPRVSRQKCVCGKKVAERSCASPLWH
CDQVCGKTLPCGNHTCEQVCHVGACGECPRSGKRFCPCQKSKFSLPCTEDVPTCGDSCDK
VLECGIHRCSQRCHRGPCETCRQEVEKHCRCGKHTKRMPCHKPYLCETKCVKMRDCQKHQ
CRRKCCPGNCPPCDQNCGRTLGCRNHKCPSVCHRGSCYPCPETVDVKCNCGNTKVTVPCG
RERTTRPPKCKEQCSRPPTCHHTSQEKHRCHFGSCPPCHQPCQKVLEKCGHLCPAPCHDQ
ALIKQTGRHQPTGPWEQPSEPAFIQTALPCPPCQVPIPMECLGKHEVSPLPCHAVGPYSC
KRVCGRILDCQNHTCMKECHKVTKTDGCTGKNKAGPECLHCEEGCSKSRPLGCLHPCILR
CHPGECPPCVQMLRIKCHCKITSLYVECRKITTADVNEKNLLSCCKNQCPKELPCGHRCK
EMCHPGECPFNCNQKVKLRCPCKRIKKELQCNKVRENQVSIECDTTCKEMKRKASEIKEA
EAKAALEEEKRRQQAELEAFENRLKGRRKKNRKRDEVAVELSLWQKHKYYLISVCGVVVV
VFAWYITHDVN
NT seq 2736 nt   +upstreamnt  +downstreamnt
atggaagcttcctggcgccaggtggccggtggccgaggccgatcccggggacgggccact
gccgccccctcaggaaatggagtccatctccgcggcgccggaggagggcgagagaagggg
tcggtgggcgcagttccttctggcaccagtcccggaggagtcgcgaccacggcggctgca
gggagcaggcacagccccgcaggatcccaagccctgcagactaccgcagccagcgagcta
atgtctcagaaaaaatttgaagaaatcaagaaagctaaccaagctgcagccagaaaactt
gttgaagaacagtttagctcttcatctgaagaaggagatgaagattttgaaggaaaacag
ggaaaaatacttgcaaatacgtttataacatacactactcagacagatggagatacacgt
gaattagagcgaacaaaacaatatgtaaatgaagcttttcaagcaggggctatgacatgc
ctaatttgtattgcttcggtgaagagaaaccaagcagtttggagctgttcgggatgtttc
tgtatatttcacatgccctgtatccagaagtgggctaaagacagccagtttcttgtatct
tctgtgactgatgatgattttggaaagaaagattgtccctggccttgtccaaaatgtagg
tttgaatacaaacgatctgaaacacctagtaggtactattgctattgtggaaaagtagaa
gatccacctttagatccgtggcttgtgcctcattcatgtggccaagtatgtgagcgtgaa
tttaaacctccttgtggccataaatgtttactcctctgtcatccaggtccctgccctcct
tgtccaaagatggtcacaactacttgttactgtaagaaagcaaaacctatccctcgtagg
tgcagtgccaaggaatggtcttgtcagctgccatgtggacagaagttgctttgtgggcaa
cataagtgtgaaaatccttgtcatgcaggaagctgtcagccttgtccaagagttagtaga
caaaagtgtgtctgtggcaaaaaagtagctgaaagaagttgtgcaagtccactatggcac
tgtgatcaagtatgtggaaaaacactgccatgtggtaatcacacatgtgagcaagtttgc
catgttggtgcttgtggagaatgtcctcgatctgggaaaaggttctgtccatgtcagaaa
tcaaagttttctttgccttgtacagaagatgtaccaacttgtggagacagttgtgacaaa
gtacttgaatgcggaatccatagatgttcacagcgttgtcaccgaggtccctgtgaaaca
tgtagacaagaagtggaaaagcattgtcgctgtggaaagcatacaaaacgaatgccttgt
cataaaccttatctgtgtgaaactaagtgtgttaagatgcgtgactgtcagaagcatcaa
tgtagaagaaagtgttgccctggaaactgtccaccttgtgatcaaaactgtggacggact
ttaggatgtagaaaccataagtgtccatctgtctgtcacagaggcagttgctatccctgc
ccagaaaccgtagatgtgaagtgtaattgtggcaatacaaaggtgacagtgccctgtggc
cgagaacgtaccacaagaccacccaagtgcaaggagcaatgcagtcgaccaccaacttgt
catcatacaagtcaagaaaaacatcgctgtcactttggttcttgtccaccatgtcatcaa
ccttgccaaaaagttttggagaaatgtggtcacttgtgtcctgctccgtgtcatgatcaa
gcattaataaagcagactggcaggcaccagcctacaggcccttgggaacagccttctgag
ccagcatttattcagactgcattaccgtgtcctccatgtcaagttcctattcctatggaa
tgtcttgggaaacatgaggtgagtccactaccatgccatgctgtaggaccctactcttgt
aaaagagtttgtggaagaatcttggattgtcagaatcacacatgtatgaaagaatgccac
aaagtaaccaaaactgatggctgcactggaaaaaacaaggctggcccagaatgccttcat
tgtgaggaagggtgctccaagtcacggccactaggttgtcttcacccatgtattttgcga
tgtcaccctggagaatgtccaccttgtgttcagatgcttagaataaaatgtcactgtaag
atcacaagcctgtatgtggaatgtagaaaaataaccacagctgatgtaaatgaaaagaac
ctcctcagttgttgcaaaaatcagtgccctaaagagcttccttgtggtcatagatgcaaa
gagatgtgtcatcctggtgaatgtccctttaactgcaaccagaaggtaaaacttagatgt
ccttgtaaaagaataaaaaaggaattgcagtgcaacaaagtacgtgaaaatcaggtttca
atagaatgtgacacaacgtgcaaggaaatgaagcggaaagcatctgagataaaagaagca
gaagccaaagctgctcttgaagaagaaaaacgaagacaacaggctgaactagaagctttt
gaaaacagactgaagggtcgtcggaagaagaacaggaaaagagatgaagtggcagttgag
ctatcactatggcaaaaacataaatattatctcatttcagtgtgtggagttgtggttgta
gtgtttgcctggtacatcacccatgatgtcaattaa

DBGET integrated database retrieval system