KEGG   Homo sapiens (human): 1528
Entry
1528              CDS       T01001                                 
Symbol
CYB5A, CYB5, MCB5, METAG
Name
(RefSeq) cytochrome b5 type A
  KO
K23490  cytochrome b5
Organism
hsa  Homo sapiens (human)
Disease
H00235  Methemoglobinemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    1528 (CYB5A)
SSDB
Motif
Pfam: Cyt-b5
Other DBs
NCBI-GeneID: 1528
NCBI-ProteinID: NP_683725
OMIM: 613218
HGNC: 2570
Ensembl: ENSG00000166347
Pharos: P00167(Tbio)
UniProt: P00167 A0A384ME44
Structure
Position
18:complement(74250846..74291963)
AA seq 134 aa
MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDAT
ENFEDVGHSTDAREMSKTFIIGELHPDDRPKLNKPPETLITTIDSSSSWWTNWVIPAISA
VAVALMYRLYMAED
NT seq 405 nt   +upstreamnt  +downstreamnt
atggcagagcagtcggacgaggccgtgaagtactacaccctagaggagattcagaagcac
aaccacagcaagagcacctggctgatcctgcaccacaaggtgtacgatttgaccaaattt
ctggaagagcatcctggtggggaagaagttttaagggaacaagctggaggtgacgctact
gagaactttgaggatgtcgggcactctacagatgccagggaaatgtccaaaacattcatc
attggggagctccatccagatgacagaccaaagttaaacaagcctccggaaactcttatc
actactattgattctagttccagttggtggaccaactgggtgatccctgccatctctgca
gtggccgtcgccttgatgtatcgcctatacatggcagaggactga

DBGET integrated database retrieval system