KEGG   Homo sapiens (human): 152926
Entry
152926            CDS       T01001                                 
Symbol
PPM1K, BDP, MSUDMV, PP2Ckappa, PP2Cm, PTMP, UG0882E07
Name
(RefSeq) protein phosphatase, Mg2+/Mn2+ dependent 1K
  KO
K17505  protein phosphatase 1K [EC:3.1.3.16]
Organism
hsa  Homo sapiens (human)
Disease
H00172  Maple syrup urine disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    152926 (PPM1K)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     152926 (PPM1K)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Mg2+- or Mn2+- dependent protein phosphatases (PPMs)
   PPM1 phosphatases (PP2C)
    152926 (PPM1K)
SSDB
Motif
Pfam: PP2C PP2C_2
Other DBs
NCBI-GeneID: 152926
NCBI-ProteinID: NP_689755
OMIM: 611065
HGNC: 25415
Ensembl: ENSG00000163644
Vega: OTTHUMG00000130952
Pharos: Q8N3J5(Tbio)
UniProt: Q8N3J5
Structure
Position
4:complement(88257620..88284561)
AA seq 372 aa
MSTAALITLVRSGGNQVRRRVLLSSRLLQDDRRVTPTCHSSTSEPRCSRFDPDGSGSPAT
WDNFGIWDNRIDEPILLPPSIKYGKPIPKISLENVGCASQIGKRKENEDRFDFAQLTDEV
LYFAVYDGHGGPAAADFCHTHMEKCIMDLLPKEKNLETLLTLAFLEIDKAFSSHARLSAD
ATLLTSGTTATVALLRDGIELVVASVGDSRAILCRKGKPMKLTIDHTPERKDEKERIKKC
GGFVAWNSLGQPHVNGRLAMTRSIGDLDLKTSGVIAEPETKRIKLHHADDSFLVLTTDGI
NFMVNSQEICDFVNQCHDPNEAAHAVTEQAIQYGTEDNSTAVVVPFGAWGKYKNSEINFS
FSRSFASSGRWA
NT seq 1119 nt   +upstreamnt  +downstreamnt
atgtcaacagctgccttaattactttggtcagaagtggtgggaaccaggtgagaaggaga
gtgctgctaagctcccgcctgctgcaggacgacaggcgggtgacacccacgtgccacagc
tccacttcagagcctaggtgttctcggtttgacccagatggtagtgggagtccagctacc
tgggacaattttgggatctgggataaccgcattgatgagccaattctgctgccacccagc
attaagtatggcaagccaattcccaaaatcagcttggaaaatgtggggtgcgcctcacag
attggcaaacggaaagagaatgaagatcggtttgacttcgctcagctgacagatgaggtc
ctgtactttgcagtgtatgatggacacggtggacctgcagcagctgatttctgtcatacc
cacatggagaaatgtattatggatttgcttcctaaggagaagaacttggaaactctgttg
accttggcttttctagaaatagataaagccttttcgagtcatgcccgcctgtctgctgat
gcaactcttctgacctctgggactactgcaacagtagccctattgcgagatggtattgaa
ctggttgtagccagtgttggggacagccgggctattttgtgtagaaaaggaaaacccatg
aagctgaccattgaccatactccagaaagaaaagatgaaaaagaaaggatcaagaaatgt
ggtggttttgtagcttggaatagtttggggcagcctcacgtaaatggcaggcttgcaatg
acaagaagtattggagatttggaccttaagaccagtggtgtcatagcagaacctgaaact
aagaggattaagttacatcatgctgatgacagcttcctggtcctcaccacagatggaatt
aacttcatggtgaatagtcaagagatttgtgactttgtcaatcagtgccatgatcccaac
gaagcagcccatgcggtgactgaacaggcaatacagtacggtactgaggataacagtact
gcagtagtagtgccttttggtgcctggggaaaatataagaactctgaaatcaacttctca
ttcagcagaagctttgcctccagtggacgatgggcctga

DBGET integrated database retrieval system