KEGG   Homo sapiens (human): 153129
Entry
153129            CDS       T01001                                 

Gene name
SLC38A9, URLC11
Definition
(RefSeq) solute carrier family 38 member 9
  KO
K14995  solute carrier family 38 (sodium-coupled neutral amino acid transporter), member 9
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    153129 (SLC38A9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    153129 (SLC38A9)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC38: System A and System N sodium-coupled neutral amino acid transporter
   153129 (SLC38A9)
SSDB
Motif
Pfam: Aa_trans
Other DBs
NCBI-GeneID: 153129
NCBI-ProteinID: NP_775785
OMIM: 616203
HGNC: 26907
Ensembl: ENSG00000177058
Vega: OTTHUMG00000131189
Pharos: Q8NBW4(Tdark)
UniProt: Q8NBW4 A0A024QZR9
Position
5q11.2
AA seq 561 aa
MANMNSDSRHLGTSEVDHERDPGPMNIQFEPSDLRSKRPFCIEPTNIVNVNHVIQRVSDH
ASAMNKRIHYYSRLTTPADKALIAPDHVVPAPEECYVYSPLGSAYKLQSYTEGYGKNTSL
VTIFMIWNTMMGTSILSIPWGIKQAGFTTGMCVIILMGLLTLYCCYRVVKSRTMMFSLDT
TSWEYPDVCRHYFGSFGQWSSLLFSLVSLIGAMIVYWVLMSNFLFNTGKFIFNFIHHIND
TDTILSTNNSNPVICPSAGSGGHPDNSSMIFYANDTGAQQFEKWWDKSRTVPFYLVGLLL
PLLNFKSPSFFSKFNILGTVSVLYLIFLVTFKAVRLGFHLEFHWFIPTEFFVPEIRFQFP
QLTGVLTLAFFIHNCIITLLKNNKKQENNVRDLCIAYMLVTLTYLYIGVLVFASFPSPPL
SKDCIEQNFLDNFPSSDTLSFIARIFLLFQMMTVYPLLGYLARVQLLGHIFGDIYPSIFH
VLILNLIIVGAGVIMACFYPNIGGIIRYSGAACGLAFVFIYPSLIYIISLHQEERLTWPK
LIFHVFIIILGVANLIVQFFM
NT seq 1686 nt   +upstreamnt  +downstreamnt
atggcaaatatgaatagtgattctaggcatcttggcacctctgaggtagatcatgaaaga
gatcctggacctatgaatatccagtttgagccatcggatctaagatccaaaaggcctttc
tgtatagagcccacaaacatcgtgaatgtgaatcatgtcattcagagggttagtgaccat
gcctctgccatgaacaagagaattcattactacagccggctcaccactcctgcagacaag
gcactgattgccccagaccatgtagttccagctccagaagagtgctatgtgtatagtcca
ttgggctctgcttataaacttcaaagttacactgaaggatacggtaaaaacaccagttta
gtaaccatttttatgatttggaataccatgatgggaacatctatactaagcattccttgg
ggcataaaacaggctggatttactactggaatgtgtgtcatcatactgatgggcctttta
acactttattgctgctacagagtagtgaaatcacggactatgatgttttcgttggatacc
actagctgggaatatccagatgtctgcagacattatttcggctcctttgggcagtggtcg
agtctccttttctccttggtgtctctcattggagcaatgatagtttattgggtgcttatg
tcaaattttctttttaatactggaaagtttatttttaattttattcatcacattaatgac
acagacactatactgagtaccaataatagcaaccctgtgatttgtccaagtgccgggagt
ggaggccatcctgacaacagctctatgattttctatgccaatgacacaggagcccaacag
tttgaaaagtggtgggataagtccaggacagtccccttttatcttgtagggctcctcctc
ccactgctcaatttcaagtctccttcatttttttcaaaatttaatatcctaggcacagtg
tctgtcctttatttgattttccttgtcacctttaaggctgttcgcttgggatttcatttg
gaatttcattggtttataccaacagaattttttgtaccagagataagatttcagtttcca
cagctgactggagtgcttacccttgctttttttattcataattgtatcatcacactcttg
aagaacaacaagaaacaagaaaacaatgtgagggacttgtgcattgcttatatgctggtg
acattaacttatctctatattggagtcctggtttttgcttcatttccttcaccaccatta
tccaaagattgtattgagcagaattttttagacaacttccctagcagtgacaccctgtcc
ttcattgcaaggatattcctgctgttccagatgatgactgtatacccactcttaggctac
ctggctcgtgtccagcttttgggccatatcttcggtgacatttatcctagcattttccat
gtgctgattcttaatctaattattgtgggagctggagtgatcatggcctgtttctaccca
aacataggagggatcataagatattcaggagcagcatgtggactggcctttgtattcata
tacccatctctcatctatataatttccctccaccaagaagagcgtctgacatggcctaaa
ttaatcttccacgttttcatcatcattttgggcgtggctaacctgattgttcagtttttt
atgtga

DBGET integrated database retrieval system