KEGG   Homo sapiens (human): 153201Help
Entry
153201            CDS       T01001                                 

Gene name
SLC36A2, PAT2, TRAMD1
Definition
(RefSeq) solute carrier family 36 member 2
  KO
K14209  solute carrier family 36 (proton-coupled amino acid transporter)
Organism
hsa  Homo sapiens (human)
Pathway
hsa04974  Protein digestion and absorption
Disease
H00905  Iminoglycinuria
H01304  Hyperglycinuria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    153201 (SLC36A2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    153201 (SLC36A2)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    153201 (SLC36A2)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Other autophagy associated proteins
   Others
    153201 (SLC36A2)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC36: Proton-coupled amino acid transporter
   153201 (SLC36A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aa_trans
Motif
Other DBs
NCBI-GeneID: 153201
NCBI-ProteinID: NP_861441
OMIM: 608331
HGNC: 18762
Ensembl: ENSG00000186335
Vega: OTTHUMG00000130129
Pharos: Q495M3(Tbio)
UniProt: Q495M3
Position
5q33.1
AA seq 483 aa AA seqDB search
MSVTKSTEGPQGAVAIKLDLMSPPESAKKLENKDSTFLDESPSESAGLKKTKGITVFQAL
IHLVKGNMGTGILGLPLAVKNAGILMGPLSLLVMGFIACHCMHILVKCAQRFCKRLNKPF
MDYGDTVMHGLEANPNAWLQNHAHWGRHIVSFFLIITQLGFCCVYIVFLADNLKQVVEAV
NSTTNNCYSNETVILTPTMDSRLYMLSFLPFLVLLVLIRNLRILTIFSMLANISMLVSLV
IIIQYITQEIPDPSRLPLVASWKTYPLFFGTAIFSFESIGVVLPLENKMKNARHFPAILS
LGMSIVTSLYIGMAALGYLRFGDDIKASISLNLPNCWLYQSVKLLYIAGILCTYALQFYV
PAEIIIPFAISRVSTRWALPLDLSIRLVMVCLTCLLAILIPRLDLVISLVGSVSGTALAL
IIPPLLEVTTFYSEGMSPLTIFKDALISILGFVGFVVGTYQALDELLKSEDSHPFSNSTT
FVR
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgacaaaaagtactgagggtccccagggagccgttgccatcaaattggacctt
atgtcgcctcctgaaagtgccaagaagttggagaacaaggactctacattcttggatgaa
agtccttcagagtcagcaggcttgaagaagaccaagggcataacagtgttccaggccttg
attcacctggtgaaaggcaacatgggcacagggatcctgggactacccctcgctgtgaag
aacgcgggcatcctgatgggcccactcagtctgctggtgatgggcttcattgcctgccac
tgtatgcacatcctggtcaagtgtgcccagcgcttctgtaagaggcttaacaagcccttt
atggactatggggacacggtgatgcatggactagaagccaaccccaacgcctggctccag
aatcacgctcactggggaaggcatatcgtgagcttcttccttattatcacccaacttggc
ttctgctgtgtgtacattgtgtttttggctgataatttaaaacaggtagtggaagctgtt
aatagcacaaccaacaactgctattccaatgagacggtgattctgacccccaccatggac
tcgcgactctacatgctctccttcctgcccttcctggtgctgctggtcctcatccggaac
ctcaggatcttgaccatcttctccatgctggccaacatcagcatgctggtcagcttggtc
atcatcatacagtacattacccaggaaatcccagaccccagccggttgccactggtagca
agctggaagacctaccctctcttcttcggaacagccattttttcttttgaaagcattggt
gtggttctgcctctggaaaacaagatgaagaatgcccgccacttcccagccatcctgtct
ttgggaatgtccatcgtcacttccctatacattggcatggcggctctgggctacctgcgg
tttggagatgacatcaaggccagcataagccttaacctgcctaactgctggctgtaccag
tctgtcaagcttctctacattgccggcatcctgtgcacctatgccctgcagttctacgtc
cctgcagaaatcatcatcccctttgccatctcccgggtgtcaacacgctgggcactgcct
ctggatctgtccattcgcctcgtcatggtctgcctgacatgcctcctggccatcctcatc
ccccgcctggacctggtcatctccctggtgggctccgtgagtggcaccgccctggccctc
atcatcccaccgctcctggaggtcaccacgttctactcagagggcatgagccccctcacc
atcttcaaggacgccctgatcagcatcctgggcttcgtgggctttgtggtggggacctac
caggccctggacgagctgctcaagtcagaagactctcaccccttttccaactccaccact
tttgttcggtga

DBGET integrated database retrieval system