KEGG   Homo sapiens (human): 153328
Entry
153328            CDS       T01001                                 

Gene name
SLC25A48
Definition
(RefSeq) solute carrier family 25 member 48
  KO
K15124  solute carrier family 25, member 48
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    153328 (SLC25A48)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   153328 (SLC25A48)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 153328
NCBI-ProteinID: NP_660325
OMIM: 616150
HGNC: 30451
Ensembl: ENSG00000145832
Vega: OTTHUMG00000157007
Pharos: Q6ZT89(Tdark)
UniProt: Q6ZT89
Position
5q31.1
AA seq 157 aa
MGSFQLEDFAAGWIGGAASVIVGHPLDTVKTRLQAGVGYGNTLSCIRVVYRRESMFGFFK
GMSFPLASIAVYNSVVFGVFSNTQRFLSQHRCGEPEASPPRTLSDLLLASMVAGVVSVGL
GGPVDLIKIRLQMQTQPFRDGGEHRMTTVFPGPHLCM
NT seq 474 nt   +upstreamnt  +downstreamnt
atgggaagcttccagctggaagactttgcggcgggctggatcggaggtgcagccagtgtc
atcgttggccaccctctggacacagtcaagactcgcctgcaggctggcgttggctacgga
aacaccctcagctgcatccgcgtggtgtacaggagggagagtatgttcggcttcttcaag
ggcatgtccttccccctcgccagcattgccgtctacaactccgtggtgtttggggtcttc
agtaacacgcagcggttcctcagccagcaccgctgcggggagccagaggccagtcctccc
cgcacgctgtcagacctgctcctggccagcatggtggccggcgtggtctctgtcgggctg
ggagggcccgtggacctcatcaagatccggttgcagatgcagacacaaccgtttcgggac
ggaggtgaacacaggatgactacagtgttccctgggcctcatctctgcatgtga

DBGET integrated database retrieval system