KEGG   Homo sapiens (human): 1536Help
Entry
1536              CDS       T01001                                 

Gene name
CYBB, AMCBX2, CGD, GP91-1, GP91-PHOX, GP91PHOX, IMD34, NOX2, p91-PHOX
Definition
(RefSeq) cytochrome b-245 beta chain
  KO
K21421  NADPH oxidase 2 [EC:1.-.-.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04066  HIF-1 signaling pathway
hsa04145  Phagosome
hsa04216  Ferroptosis
hsa04217  Necroptosis
hsa04621  NOD-like receptor signaling pathway
hsa04670  Leukocyte transendothelial migration
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05140  Leishmaniasis
Disease
H00089  IFN-gamma/IL-12 axis
H00098  Chronic granulomatous disease
H01167  Gluconobacter infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    1536 (CYBB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    1536 (CYBB)
  09143 Cell growth and death
   04216 Ferroptosis
    1536 (CYBB)
   04217 Necroptosis
    1536 (CYBB)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    1536 (CYBB)
   04670 Leukocyte transendothelial migration
    1536 (CYBB)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    1536 (CYBB)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    1536 (CYBB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    1536 (CYBB)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.-  
   1.-.-  
    1.-.-.-  
     1536 (CYBB)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   NADPH oxidase complex
    1536 (CYBB)
 Others
  NADPH oxidases (Nox) and associated proteins
   NADPH oxidases
    1536 (CYBB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_6 Ferric_reduct FAD_binding_8 FAD_binding_6 NAD_binding_1
Motif
Other DBs
NCBI-GeneID: 1536
NCBI-ProteinID: NP_000388
OMIM: 300481
HGNC: 2578
Ensembl: ENSG00000165168
Vega: OTTHUMG00000033175
Pharos: P04839(Tchem)
UniProt: P04839 A0A0S2Z3S6
Structure
PDB: 

Position
Xp21.1-p11.4
AA seq 570 aa AA seqDB search
MGNWAVNEGLSIFVILVWLGLNVFLFVWYYRVYDIPPKFFYTRKLLGSALALARAPAACL
NFNCMLILLPVCRNLLSFLRGSSACCSTRVRRQLDRNLTFHKMVAWMIALHSAIHTIAHL
FNVEWCVNARVNNSDPYSVALSELGDRQNESYLNFARKRIKNPEGGLYLAVTLLAGITGV
VITLCLILIITSSTKTIRRSYFEVFWYTHHLFVIFFIGLAIHGAERIVRGQTAESLAVHN
ITVCEQKISEWGKIKECPIPQFAGNPPMTWKWIVGPMFLYLCERLVRFWRSQQKVVITKV
VTHPFKTIELQMKKKGFKMEVGQYIFVKCPKVSKLEWHPFTLTSAPEEDFFSIHIRIVGD
WTEGLFNACGCDKQEFQDAWKLPKIAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASIL
KSVWYKYCNNATNLKLKKIYFYWLCRDTHAFEWFADLLQLLESQMQERNNAGFLSYNIYL
TGWDESQANHFAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASQHPNTRIGVFLCGPE
ALAETLSKQSISNSESGPRGVHFIFNKENF
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atggggaactgggctgtgaatgaggggctctccatttttgtcattctggtttggctgggg
ttgaacgtcttcctctttgtctggtattaccgggtttatgatattccacctaagttcttt
tacacaagaaaacttcttgggtcagcactggcactggccagggcccctgcagcctgcctg
aatttcaactgcatgctgattctcttgccagtctgtcgaaatctgctgtccttcctcagg
ggttccagtgcgtgctgctcaacaagagttcgaagacaactggacaggaatctcaccttt
cataaaatggtggcatggatgattgcacttcactctgcgattcacaccattgcacatcta
tttaatgtggaatggtgtgtgaatgcccgagtcaataattctgatccttattcagtagca
ctctctgaacttggagacaggcaaaatgaaagttatctcaattttgctcgaaagagaata
aagaaccctgaaggaggcctgtacctggctgtgaccctgttggcaggcatcactggagtt
gtcatcacgctgtgcctcatattaattatcacttcctccaccaaaaccatccggaggtct
tactttgaagtcttttggtacacacatcatctctttgtgatcttcttcattggccttgcc
atccatggagctgaacgaattgtacgtgggcagaccgcagagagtttggctgtgcataat
ataacagtttgtgaacaaaaaatctcagaatggggaaaaataaaggaatgcccaatccct
cagtttgctggaaaccctcctatgacttggaaatggatagtgggtcccatgtttctgtat
ctctgtgagaggttggtgcggttttggcgatctcaacagaaggtggtcatcaccaaggtg
gtcactcaccctttcaaaaccatcgagctacagatgaagaagaaggggttcaaaatggaa
gtgggacaatacatttttgtcaagtgcccaaaggtgtccaagctggagtggcaccctttt
acactgacatccgcccctgaggaagacttctttagtatccatatccgcatcgttggggac
tggacagaggggctgttcaatgcttgtggctgtgataagcaggagtttcaagatgcgtgg
aaactacctaagatagcggttgatgggccctttggcactgccagtgaagatgtgttcagc
tatgaggtggtgatgttagtgggagcagggattggggtcacacccttcgcatccattctc
aagtcagtctggtacaaatattgcaataacgccaccaatctgaagctcaaaaagatctac
ttctactggctgtgccgggacacacatgcctttgagtggtttgcagatctgctgcaactg
ctggagagccagatgcaggaaaggaacaatgccggcttcctcagctacaacatctacctc
actggctgggatgagtctcaggccaatcactttgctgtgcaccatgatgaggagaaagat
gtgatcacaggcctgaaacaaaagactttgtatggacggcccaactgggataatgaattc
aagacaattgcaagtcaacaccctaataccagaataggagttttcctctgtggacctgaa
gccttggctgaaaccctgagtaaacaaagcatctccaactctgagtctggccctcgggga
gtgcatttcattttcaacaaggaaaacttctaa

DBGET integrated database retrieval system