KEGG   Homo sapiens (human): 1536
Entry
1536              CDS       T01001                                 

Gene name
CYBB, AMCBX2, CGD, GP91-1, GP91-PHOX, GP91PHOX, IMD34, NOX2, p91-PHOX
Definition
(RefSeq) cytochrome b-245 beta chain
  KO
K21421  NADPH oxidase 2 [EC:1.-.-.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04066  HIF-1 signaling pathway
hsa04145  Phagosome
hsa04216  Ferroptosis
hsa04217  Necroptosis
hsa04621  NOD-like receptor signaling pathway
hsa04670  Leukocyte transendothelial migration
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05010  Alzheimer disease
hsa05140  Leishmaniasis
Disease
H00089  IFN-gamma/IL-12 axis
H00098  Chronic granulomatous disease
H01167  Gluconobacter infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    1536 (CYBB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    1536 (CYBB)
  09143 Cell growth and death
   04216 Ferroptosis
    1536 (CYBB)
   04217 Necroptosis
    1536 (CYBB)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    1536 (CYBB)
   04670 Leukocyte transendothelial migration
    1536 (CYBB)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    1536 (CYBB)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    1536 (CYBB)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    1536 (CYBB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    1536 (CYBB)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.-  
   1.-.-  
    1.-.-.-  
     1536 (CYBB)
Membrane trafficking [BR:hsa04131]
 Others
  NADPH oxidases (Nox) and associated proteins
   NADPH oxidases
    1536 (CYBB)
SSDB
Motif
Pfam: NAD_binding_6 Ferric_reduct FAD_binding_8 FAD_binding_6 NAD_binding_1
Other DBs
NCBI-GeneID: 1536
NCBI-ProteinID: NP_000388
OMIM: 300481
HGNC: 2578
Ensembl: ENSG00000165168
Vega: OTTHUMG00000033175
Pharos: P04839(Tchem)
UniProt: P04839 A0A0S2Z3S6
Structure
PDB: 
3A1F

Position
Xp21.1-p11.4
AA seq 570 aa
MGNWAVNEGLSIFVILVWLGLNVFLFVWYYRVYDIPPKFFYTRKLLGSALALARAPAACL
NFNCMLILLPVCRNLLSFLRGSSACCSTRVRRQLDRNLTFHKMVAWMIALHSAIHTIAHL
FNVEWCVNARVNNSDPYSVALSELGDRQNESYLNFARKRIKNPEGGLYLAVTLLAGITGV
VITLCLILIITSSTKTIRRSYFEVFWYTHHLFVIFFIGLAIHGAERIVRGQTAESLAVHN
ITVCEQKISEWGKIKECPIPQFAGNPPMTWKWIVGPMFLYLCERLVRFWRSQQKVVITKV
VTHPFKTIELQMKKKGFKMEVGQYIFVKCPKVSKLEWHPFTLTSAPEEDFFSIHIRIVGD
WTEGLFNACGCDKQEFQDAWKLPKIAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASIL
KSVWYKYCNNATNLKLKKIYFYWLCRDTHAFEWFADLLQLLESQMQERNNAGFLSYNIYL
TGWDESQANHFAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASQHPNTRIGVFLCGPE
ALAETLSKQSISNSESGPRGVHFIFNKENF
NT seq 1713 nt   +upstreamnt  +downstreamnt
atggggaactgggctgtgaatgaggggctctccatttttgtcattctggtttggctgggg
ttgaacgtcttcctctttgtctggtattaccgggtttatgatattccacctaagttcttt
tacacaagaaaacttcttgggtcagcactggcactggccagggcccctgcagcctgcctg
aatttcaactgcatgctgattctcttgccagtctgtcgaaatctgctgtccttcctcagg
ggttccagtgcgtgctgctcaacaagagttcgaagacaactggacaggaatctcaccttt
cataaaatggtggcatggatgattgcacttcactctgcgattcacaccattgcacatcta
tttaatgtggaatggtgtgtgaatgcccgagtcaataattctgatccttattcagtagca
ctctctgaacttggagacaggcaaaatgaaagttatctcaattttgctcgaaagagaata
aagaaccctgaaggaggcctgtacctggctgtgaccctgttggcaggcatcactggagtt
gtcatcacgctgtgcctcatattaattatcacttcctccaccaaaaccatccggaggtct
tactttgaagtcttttggtacacacatcatctctttgtgatcttcttcattggccttgcc
atccatggagctgaacgaattgtacgtgggcagaccgcagagagtttggctgtgcataat
ataacagtttgtgaacaaaaaatctcagaatggggaaaaataaaggaatgcccaatccct
cagtttgctggaaaccctcctatgacttggaaatggatagtgggtcccatgtttctgtat
ctctgtgagaggttggtgcggttttggcgatctcaacagaaggtggtcatcaccaaggtg
gtcactcaccctttcaaaaccatcgagctacagatgaagaagaaggggttcaaaatggaa
gtgggacaatacatttttgtcaagtgcccaaaggtgtccaagctggagtggcaccctttt
acactgacatccgcccctgaggaagacttctttagtatccatatccgcatcgttggggac
tggacagaggggctgttcaatgcttgtggctgtgataagcaggagtttcaagatgcgtgg
aaactacctaagatagcggttgatgggccctttggcactgccagtgaagatgtgttcagc
tatgaggtggtgatgttagtgggagcagggattggggtcacacccttcgcatccattctc
aagtcagtctggtacaaatattgcaataacgccaccaatctgaagctcaaaaagatctac
ttctactggctgtgccgggacacacatgcctttgagtggtttgcagatctgctgcaactg
ctggagagccagatgcaggaaaggaacaatgccggcttcctcagctacaacatctacctc
actggctgggatgagtctcaggccaatcactttgctgtgcaccatgatgaggagaaagat
gtgatcacaggcctgaaacaaaagactttgtatggacggcccaactgggataatgaattc
aagacaattgcaagtcaacaccctaataccagaataggagttttcctctgtggacctgaa
gccttggctgaaaccctgagtaaacaaagcatctccaactctgagtctggccctcgggga
gtgcatttcattttcaacaaggaaaacttctaa

KEGG   Homo sapiens (human): 27035
Entry
27035             CDS       T01001                                 

Gene name
NOX1, GP91-2, MOX1, NOH-1, NOH1
Definition
(RefSeq) NADPH oxidase 1
  KO
K08008  NADPH oxidase 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04380  Osteoclast differentiation
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05010  Alzheimer disease
hsa05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    27035 (NOX1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    27035 (NOX1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    27035 (NOX1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    27035 (NOX1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    27035 (NOX1)
Membrane trafficking [BR:hsa04131]
 Others
  NADPH oxidases (Nox) and associated proteins
   NADPH oxidases
    27035 (NOX1)
SSDB
Motif
Pfam: NAD_binding_6 Ferric_reduct FAD_binding_8 NAD_binding_1 FAD_binding_6
Other DBs
NCBI-GeneID: 27035
NCBI-ProteinID: NP_008983
OMIM: 300225
HGNC: 7889
Ensembl: ENSG00000007952
Vega: OTTHUMG00000022007
Pharos: Q9Y5S8(Tchem)
UniProt: Q9Y5S8
Position
Xq22.1
AA seq 564 aa
MGNWVVNHWFSVLFLVVWLGLNVFLFVDAFLKYEKADKYYYTRKILGSTLACARASALCL
NFNSTLILLPVCRNLLSFLRGTCSFCSRTLRKQLDHNLTFHKLVAYMICLHTAIHIIAHL
FNFDCYSRSRQATDGSLASILSSLSHDEKKGGSWLNPIQSRNTTVEYVTFTSIAGLTGVI
MTIALILMVTSATEFIRRSYFEVFWYTHHLFIFYILGLGIHGIGGIVRGQTEESMNESHP
RKCAESFEMWDDRDSHCRRPKFEGHPPESWKWILAPVILYICERILRFYRSQQKVVITKV
VMHPSKVLELQMNKRGFSMEVGQYIFVNCPSISLLEWHPFTLTSAPEEDFFSIHIRAAGD
WTENLIRAFEQQYSPIPRIEVDGPFGTASEDVFQYEVAVLVGAGIGVTPFASILKSIWYK
FQCADHNLKTKKIYFYWICRETGAFSWFNNLLTSLEQEMEELGKVGFLNYRLFLTGWDSN
IVGHAALNFDKATDIVTGLKQKTSFGRPMWDNEFSTIATSHPKSVVGVFLCGPRTLAKSL
RKCCHRYSSLDPRKVQFYFNKENF
NT seq 1695 nt   +upstreamnt  +downstreamnt
atgggaaactgggtggttaaccactggttttcagttttgtttctggttgtttggttaggg
ctgaatgttttcctgtttgtggatgccttcctgaaatatgagaaggccgacaaatactac
tacacaagaaaaatccttgggtcaacattggcctgtgcccgagcgtctgctctctgcttg
aattttaacagcacgctgatcctgcttcctgtgtgtcgcaatctgctgtccttcctgagg
ggcacctgctcattttgcagccgcacactgagaaagcaattggatcacaacctcaccttc
cacaagctggtggcctatatgatctgcctacatacagctattcacatcattgcacacctg
tttaactttgactgctatagcagaagccgacaggccacagatggctcccttgcctccatt
ctctccagcctatctcatgatgagaaaaaggggggttcttggctaaatcccatccagtcc
cgaaacacgacagtggagtatgtgacattcaccagcattgctggtctcactggagtgatc
atgacaatagccttgattctcatggtaacttcagctactgagttcatccggaggagttat
tttgaagtcttctggtatactcaccacctttttatcttctatatccttggcttagggatt
cacggcattggtggaattgtccggggtcaaacagaggagagcatgaatgagagtcatcct
cgcaagtgtgcagagtcttttgagatgtgggatgatcgtgactcccactgtaggcgccct
aagtttgaagggcatccccctgagtcttggaagtggatccttgcaccggtcattctttat
atctgtgaaaggatcctccggttttaccgctcccagcagaaggttgtgattaccaaggtt
gttatgcacccatccaaagttttggaattgcagatgaacaagcgtggcttcagcatggaa
gtggggcagtatatctttgttaattgcccctcaatctctctcctggaatggcatcctttt
actttgacctctgctccagaggaagatttcttctccattcatatccgagcagcaggggac
tggacagaaaatctcataagggctttcgaacaacaatattcaccaattcccaggattgaa
gtggatggtccctttggcacagccagtgaggatgttttccagtatgaagtggctgtgctg
gttggagcaggaattggggtcaccccctttgcttctatcttgaaatccatctggtacaaa
ttccagtgtgcagaccacaacctcaaaacaaaaaagatctatttctactggatctgcagg
gagacaggtgccttttcctggttcaacaacctgttgacttccctggaacaggagatggag
gaattaggcaaagtgggttttctaaactaccgtctcttcctcaccggatgggacagcaat
attgttggtcatgcagcattaaactttgacaaggccactgacatcgtgacaggtctgaaa
cagaaaacctcctttgggagaccaatgtgggacaatgagttttctacaatagctacctcc
caccccaagtctgtagtgggagttttcttatgtggccctcggactttggcaaagagcctg
cgcaaatgctgtcaccgatattccagtctggatcctagaaaggttcaattctacttcaac
aaagaaaatttttga

KEGG   Homo sapiens (human): 50508
Entry
50508             CDS       T01001                                 

Gene name
NOX3, GP91-3, MOX-2
Definition
(RefSeq) NADPH oxidase 3
  KO
K21422  NADPH oxidase 3 [EC:1.6.3.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    50508 (NOX3)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.3  With oxygen as acceptor
    1.6.3.-  
     50508 (NOX3)
Membrane trafficking [BR:hsa04131]
 Others
  NADPH oxidases (Nox) and associated proteins
   NADPH oxidases
    50508 (NOX3)
SSDB
Motif
Pfam: NAD_binding_6 Ferric_reduct FAD_binding_8 FAD_binding_6 Ni_hydr_CYTB
Other DBs
NCBI-GeneID: 50508
NCBI-ProteinID: NP_056533
OMIM: 607105
HGNC: 7890
Ensembl: ENSG00000074771
Vega: OTTHUMG00000015883
Pharos: Q9HBY0(Tbio)
UniProt: Q9HBY0
Position
6q25.3
AA seq 568 aa
MMGCWILNEGLSTILVLSWLGINFYLFIDTFYWYEEEESFHYTRVILGSTLAWARASALC
LNFNCMLILIPVSRNLISFIRGTSICCRGPWRRQLDKNLRFHKLVAYGIAVNATIHIVAH
FFNLERYHWSQSEEAQGLLAALSKLGNTPNESYLNPVRTFPTNTTTELLRTIAGVTGLVI
SLALVLIMTSSTEFIRQASYELFWYTHHVFIVFFLSLAIHGTGRIVRGQTQDSLSLHNIT
FCRDRYAEWQTVAQCPVPQFSGKEPSAWKWILGPVVLYACERIIRFWRFQQEVVITKVVS
HPSGVLELHMKKRGFKMAPGQYILVQCPAISSLEWHPFTLTSAPQEDFFSVHIRAAGDWT
AALLEAFGAEGQALQEPWSLPRLAVDGPFGTALTDVFHYPVCVCVAAGIGVTPFAALLKS
IWYKCSEAQTPLKLSKVYFYWICRDARAFEWFADLLLSLETRMSEQGKTHFLSYHIFLTG
WDENQALHIALHWDENTDVITGLKQKTFYGRPNWNNEFKQIAYNHPSSSIGVFFCGPKAL
SRTLQKMCHLYSSADPRGVHFYYNKESF
NT seq 1707 nt   +upstreamnt  +downstreamnt
atgatggggtgctggattttgaatgagggtctctccaccatattagtactctcatggctg
ggaataaatttttatctgtttattgacacgttctactggtatgaagaggaggagtctttc
cattacacacgagttattttgggttcaacactggcttgggcacgagcatccgcactgtgc
ctgaattttaactgcatgctaattctaatacctgtcagtcgaaaccttatttcattcata
agaggaacaagtatttgctgcagaggaccgtggaggaggcaattagacaaaaacctcaga
tttcacaaactggtcgcctatgggatagctgttaatgcaaccatccacatcgtggcgcat
ttcttcaacctggaacgctaccactggagccagtccgaggaggcccagggacttctggcc
gcactttccaagctgggcaacacccctaacgagagctacctcaaccctgtccggaccttc
cccacaaacacaaccactgaattgctaaggacaatagcaggcgtcaccggtctggtgatc
tctctggctttagtcttgatcatgacctcgtcaactgagttcatcagacaggcctcctat
gagttgttctggtacacacaccatgttttcatcgtcttctttctcagcctggccatccat
gggacgggtcggattgttcgaggccaaacccaagacagtctctctctgcacaacatcacc
ttctgtagagaccgctatgcagaatggcagacagtggcccaatgccccgtgcctcaattt
tctggcaaggaaccctcggcttggaaatggattttaggccctgtggtcttgtatgcatgt
gaaagaataattaggttctggcgatttcaacaagaagttgtcattaccaaggtggtaagc
cacccctctggagtcctggaacttcacatgaaaaagcgtggctttaaaatggcgccaggg
cagtacatcttggtgcagtgcccagccatatcttcgctggagtggcaccccttcaccctt
acctctgccccccaggaggactttttcagcgtgcacatccgggcagcaggagactggaca
gcagcgctactggaggcctttggggcagagggacaggccctccaggagccctggagcctg
ccaaggctggcagtggacgggccctttggaactgccctgacagatgtatttcactaccca
gtgtgtgtgtgcgttgccgcggggatcggagtcactcccttcgctgctcttctgaaatct
atatggtacaaatgcagtgaggcacagaccccactgaagctgagcaaggtgtatttctac
tggatttgccgggatgcaagagcttttgagtggtttgctgatctcttactctccctggaa
acacggatgagtgagcaggggaaaactcactttctgagttatcatatatttcttaccggc
tgggatgaaaatcaggctcttcacatagctttacactgggacgaaaatactgacgtgatt
acaggcttaaagcagaagaccttctatgggaggcccaactggaacaatgagttcaagcag
attgcctacaatcaccccagcagcagtattggcgtgttcttctgtggacctaaagctctc
tcgaggacacttcaaaagatgtgccacttgtattcatcagctgaccccagaggtgttcat
ttctattacaacaaggagagcttctag

DBGET integrated database retrieval system