KEGG   Homo sapiens (human): 153733
Entry
153733            CDS       T01001                                 
Symbol
CCDC112, MBC1
Name
(RefSeq) coiled-coil domain containing 112
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: DivIC Baculo_PEP_C NPV_P10
Other DBs
NCBI-GeneID: 153733
NCBI-ProteinID: NP_689762
HGNC: 28599
Ensembl: ENSG00000164221
Pharos: Q8NEF3(Tbio)
UniProt: Q8NEF3
Position
5:complement(115267190..115296654)
AA seq 446 aa
MEKDKHSHFYNQKSDFRIEHSMLEELENKLIHSRKTERAKIQQQLAKIHNNVKKLQHQLK
DVKPTPDFVEKLREMMEEIENAINTFKEEQRLIYEELIKEEKTTNNELSAISRKIDTWAL
GNSETEKAFRAISSKVPVDKVTPSTLPEEVLDFEKFLQQTGGRQGAWDDYDHQNFVKVRN
KHKGKPTFMEEVLEHLPGKTQDEVQQHEKWYQKFLALEERKKESIQIWKTKKQQKREEIF
KLKEKADNTPVLFHNKQEDNQKQKEEQRKKQKLAVEAWKKQKSIEMSMKCASQLKEEEEK
EKKHQKERQRQFKLKLLLESYTQQKKEQEEFLRLEKEIREKAEKAEKRKNAADEISRFQE
RDLHKLELKILDRQAKEDEKSQKQRRLAKLKEKVENNVSRDPSRLYKPTKGWEERTKKIG
PTGSGPLLHIPHRAIPTWRQGIQRRV
NT seq 1341 nt   +upstreamnt  +downstreamnt
atggaaaaagataaacacagtcatttctacaaccaaaaaagtgacttcagaattgagcat
agtatgctagaagaattggaaaataaattgattcacagcaggaaaacagaaagagcaaaa
atccagcaacaattggccaaaatacataataatgtaaagaaacttcagcatcaattaaaa
gatgtgaagcctacacctgattttgttgagaagctcagagaaatgatggaagaaattgaa
aatgcaattaacacttttaaagaagagcagaggttgatatatgaagagctaattaaagaa
gagaagacaactaataatgagttgagtgccatatcaagaaaaattgacacatgggctttg
ggtaattcagaaacagagaaagctttcagagcaatctcaagcaaagttcctgtagacaaa
gtaacaccaagtactcttccagaagaggtactagattttgaaaaattccttcagcaaaca
ggagggcgacaaggtgcctgggatgattatgatcaccagaactttgtaaaggtgagaaac
aaacataaagggaagccaacatttatggaagaagttctagaacaccttcctggaaaaaca
caagatgaagttcaacagcatgaaaaatggtatcaaaagtttctggctctagaagaaaga
aaaaaagagtcaattcagatttggaaaactaaaaagcagcaaaaaagggaggaaattttc
aagttaaaggaaaaggcagacaacacacctgtgctttttcataataaacaagaggataat
caaaagcaaaaagaggaacaaagaaagaaacagaaattggcagttgaagcttggaagaaa
cagaaaagtatagaaatgtcaatgaaatgtgcttcccagttaaaagaagaagaagagaaa
gagaaaaaacatcagaaagaacgccagcgccagtttaagttaaaattactactagaaagt
tatacccagcagaagaaagaacaggaagaatttttgaggcttgaaaaggagataagggaa
aaggcagaaaaggcagaaaaaaggaaaaatgctgctgatgaaatttccagatttcaagaa
agagatttacataaacttgaactgaaaattctagatagacaggcaaaggaagatgaaaag
tcacaaaaacaaagaagactggcaaaattaaaagaaaaggttgaaaacaatgttagtaga
gatccctctaggctttacaaacccaccaaaggttgggaagaacgaaccaaaaagatagga
ccaacaggctctgggccacttctacatatcccacatagggctattccaacctggagacaa
ggaatacagagaagagtatga

DBGET integrated database retrieval system