KEGG   Homo sapiens (human): 1538
Entry
1538              CDS       T01001                                 

Gene name
CYLC1, CYCL1
Definition
(RefSeq) cylicin 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Cylicin_N
Other DBs
NCBI-GeneID: 1538
NCBI-ProteinID: NP_066941
OMIM: 300768
HGNC: 2582
Ensembl: ENSG00000183035
Vega: OTTHUMG00000021922
Pharos: P35663(Tdark)
UniProt: P35663 Q6PEK4
Position
Xq21.1
AA seq 651 aa
MSLPRLLKVNIRTYDNSIPISESSRKSWNQKHFALTFPKPLQRGTNDKSRPLKSQITVTR
HDKRKLEEGQKPAHKWIRHSFRKILQWPPIYTAAREQTPFRHLYTSKTHLKKAEYKKSKD
EKGGTPLKKDSKKKGGSYATNPESKQIVEEKTKRQNEADKTPLKSSHENEQSKKSKSSSE
TNPESQNSKTVSKNCSQKDKKDSKNSKKTNTEFLHTKNNPKKDLKRSKTSNDPISEICSE
NSLNVDFLMLVGQSDDESINFDAWLRNYSQNNSKNYSLKYTKYTKKDTKKNAKKSSDAES
EDSKDAKKDSKKVKKNVKKDDKKKDVKKDTESTDAESGDSKDERKDTKKDKKKLKKDDKK
KDTKKYPESTDTESGDAKDARNDSRNLKKASKNDDKKKDAKKITFSTDSESELESKESQK
DEKKDKKDSKTDNKKSVKNDEESTDADSEPKGDSKKGKKDEKKGKKDSKKDDKKKDAKKN
AESTEMESDLELKKDKKHSKEKKGSKKDIKKDARKDTESTDAEFDESSKTGFKTSTKIKG
SDTESEESLYKPGAKKKIDESDGTSANSKMEGLESKRGFRMSSKKTTFNEKGEKASTGRV
PPSREKPPLPACEPSLPSPKVRRLCWCKMPPPPPKPRYAPLPEAPWIHKLL
NT seq 1956 nt   +upstreamnt  +downstreamnt
atgtctcttccaaggttgctaaaagtaaacatcagaacatatgataattccattccaatc
agtgaatcaagcagaaaatcatggaatcaaaaacactttgctttgacatttcccaaacca
ctccagagaggtacaaatgataaatcaagacctttgaaatcacaaataacagttactaga
catgacaaaagaaaactagaagaaggccagaaaccagctcataaatggataaggcattct
ttcagaaaaattttgcaatggccacccatttacacagctgccagggaacagactccattc
agacatctttatacttccaaaacccatcttaaaaaagcagaatataaaaagtccaaagat
gaaaaaggaggaacacctttgaagaaagattccaagaaaaaaggaggttcatatgcaaca
aatccagaatccaagcaaatagtagaagagaaaactaaaagacaaaatgaggcagataaa
actcccttaaaatcatcacatgaaaatgaacaatccaagaagtcaaaatccagttcagaa
actaatccagaatcccaaaattctaagacagtctcaaaaaattgttcacaaaaagataag
aaagattcaaagaattccaagaagacaaacactgaattcctacatacaaagaacaatcca
aagaaagatttgaagaggtcaaagactagtaatgatcccatatcagagatttgctcagaa
aatagtttaaatgttgatttcctcatgttagtgggacagtctgatgatgaatccataaat
tttgatgcatggttaaggaattactcacagaataattcaaagaattattctttgaagtat
acaaagtatacaaagaaggacacaaaaaagaatgcaaagaaaagctctgatgctgaatct
gaagactcaaaggatgctaagaaagattcaaagaaagttaagaaaaatgtcaagaaagat
gacaagaaaaaggatgtaaagaaggacacagagtctactgatgctgaatctggagactca
aaggatgaaaggaaagatacaaagaaggataagaaaaaattaaagaaagatgacaagaaa
aaggacacaaagaagtacccagagtctactgatactgaatcaggagatgcaaaggatgca
agaaatgattcaagaaatttgaagaaagcttcaaagaatgatgacaagaaaaaggatgca
aagaaaattacattctctactgattctgaatctgaactggagtcaaaggagagtcagaaa
gatgaaaaaaaggataaaaaagattcaaagacagataataaaaagtctgtcaagaatgat
gaagagtctactgatgctgactctgaaccgaagggagattcaaaaaagggtaaaaaggat
gaaaagaaggggaagaaagattcaaagaaagatgacaaaaagaaggatgcaaagaaaaat
gcagaatctactgaaatggaatctgatttggagttaaagaaggacaagaaacactcaaag
gaaaagaaaggttcaaagaaagatatcaagaaggatgcaagaaaggacacagagtctact
gatgctgaatttgatgaatcttccaagacaggctttaaaacatctacaaaaatcaaaggt
tcagatactgaatctgaagagtcactatataaacctggggctaagaagaaaattgatgaa
tcagatggcacatctgcaaattcaaagatggaaggactggaatcaaagagaggattcaga
atgtcatccaaaaagactacattcaatgaaaaaggggaaaaagcaagtacaggtagagtt
cctccatcaagagaaaaaccaccactccctgcttgtgagccttctctaccatcaccaaag
gtcagacgtctttgttggtgcaagatgcctcctccacctccaaaaccaagatatgctcct
ttgcctgaagcaccgtggattcataagctgctttaa

DBGET integrated database retrieval system