KEGG   Homo sapiens (human): 154Help
Entry
154               CDS       T01001                                 

Gene name
ADRB2, ADRB2R, ADRBR, B2AR, BAR, BETA2AR
Definition
(RefSeq) adrenoceptor beta 2
  KO
K04142  adrenergic receptor beta-2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04923  Regulation of lipolysis in adipocytes
hsa04924  Renin secretion
hsa04970  Salivary secretion
Disease
H00079  Asthma
H02106  Genetic obesity
Drug target
Abediterol (DG01232): D10219 D10220
Adaprolol maleate: D02765
Alprenolol (DG00303): D01182 D07156
Alprenoxime hydrochloride: D02834
Amosulalol (DG01302): D01469 D07451
Arformoterol (DG01233): D02981 D07463
Arotinolol (DG01303): D01830 D07465
Bambuterol (DG01060): D07377 D07489
Batefenterol (DG01627): D10545 D10546
Bedoradrine sulfate: D06562
Befunolol (DG01138): D01512 D07496
Beradilol monoethyl maleate: D09843
Bitolterol (DG01056): D00684 D07534
Bopindolol (DG00310): D01794 D07537
Bucindolol hydrochloride: D03170
Bucumolol hydrochloride: D01492
Bufetolol hydrochloride: D01504
Bunitrolol hydrochloride: D01444
Bunolol hydrochloride: D03177
Bupranolol (DG00311): D01454 D07590
Butoxamine hydrochloride: D03198
Carazolol: D07608
Carbuterol: D03402
Carteolol (DG00308): D00599 D07624
Carvedilol (DG00321): D00255 D03415
Cimaterol: D03502
Clenbuterol (DG01053): D01360 D07713
Cloranolol: D07183
Clorprenaline hydrochloride: D01835
Colterol mesylate: D03587
Dexpropranolol hydrochloride: D03729
Diacetolol hydrochloride: D03759
Dilevalol hydrochloride: D01906
Dipivefrine (DG01129): D01017 D02349
Dopexamine (DG00222): D03891 D03892
Droxidopa: D01277
Ephedrine (DG00227): D00124 D01386 D04018
Epinephrine (DG00013): D00095 D00996 D02149
Epinephryl borate: D04026
Etafedrine hydrochloride: D04072
Etilefrine (DG00210): D01573 D07931
Exaprolol hydrochloride: D04120
Fenoterol (DG00451): D01428 D04157
Flestolol sulfate: D04190
Formoterol (DG01052): D01373 D05277 D07990
Hexoprenaline (DG01047): D02396 D08039
Indacaterol (DG01057): D09318 D09319 D11009
Indenolol (DG01323): D01958 D08078
Isoetarine (DG01234): D02093 D04625 D04626
Isoprenaline (DG00211): D01390 D02066 D02150 D08090
Isoxsuprine (DG00277): D01748 D08092 D08093
Labetalol (DG00320): D00600 D08106
Levalbuterol  
Levosalbutamol (DG01235): D02281 D04701 D04703 D08124
Levobunolol (DG01136): D01025 D08115
Mabuterol hydrochloride: D01589
Medroxalol (DG01317): D04888 D04889
Mepindolol: D07181
Metalol hydrochloride: D04953
Methoxyphenamine: D01635
Methylephedrine (DG01229): D01952 D02109 D08206 D09842
Metipranolol (DG01137): D02081 D02374
Milveterol hydrochloride: D08945
Nadolol: D00432
Nipradilol: D01691
Norepinephrine (DG00212): D00076 D05206 D08284 D09794
Octodrine: D05228
Olodaterol (DG01058): D10020 D10145
Orciprenaline (DG01044): D00685 D04954 D08300
Oxprenolol (DG00304): D01806 D08318
Pamatolol sulfate: D05345
Penbutolol (DG00312): D00602 D08074
Phenylpropanolamine (DG01041): D01224 D05466 D08368
Picumeterol fumarate: D05476
Pindolol: D00513
Pirbuterol (DG01048): D00686 D01349 D08387
Primidolol: D02389
Procaterol (DG01055): D02404 D05366 D08424
Propranolol (DG00305): D00483 D08443
Pseudoephedrine (DG01042): D00485 D05648 D05649 D08449
Racephedrine Hydrochloride: D08982
Racepinephrine (DG01444): D05688 D05689
Ractopamine hydrochloride: D05691
Reproterol (DG01054): D05718 D08474
Rimiterol: D05730
Ritodrine (DG00450): D01263 D02359
Salbutamol (DG01045): D00683 D02147
Salmeterol (DG01051): D00687 D05792
Sibenadet hydrochloride: D05832
Sotalol (DG00307): D01026 D08525
Soterenol hydrochloride: D05902
Talinolol: D07184
Tazolol hydrochloride: D06014
Terbutaline (DG01046): D00688 D08570
Tertatolol (DG00309): D07182 D08572
Tilisolol (DG01322): D01795 D08598
Timolol (DG00306): D00378 D00603 D08600
Tiprenolol hydrochloride: D06162
Tolamolol: D06176
Tretoquinol (DG01049): D01978 D05037 D08629
Tulobuterol (DG01050): D01362 D02151
Vilanterol (DG01236): D09696 D09697
Zinterol hydrochloride: D06374
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    154 (ADRB2)
   04024 cAMP signaling pathway
    154 (ADRB2)
   04022 cGMP-PKG signaling pathway
    154 (ADRB2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    154 (ADRB2)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    154 (ADRB2)
   04924 Renin secretion
    154 (ADRB2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    154 (ADRB2)
  09154 Digestive system
   04970 Salivary secretion
    154 (ADRB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    154 (ADRB2)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Biogenic amine
   Adrenaline
    154 (ADRB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4 7TM_GPCR_Srv
Motif
Other DBs
NCBI-GeneID: 154
NCBI-ProteinID: NP_000015
OMIM: 109690
HGNC: 286
Ensembl: ENSG00000169252
Vega: OTTHUMG00000129933
Pharos: P07550(Tclin)
UniProt: P07550
Structure
PDB: 

Position
5q32
AA seq 413 aa AA seqDB search
MGQPGNGSAFLLAPNRSHAPDHDVTQQRDEVWVVGMGIVMSLIVLAIVFGNVLVITAIAK
FERLQTVTNYFITSLACADLVMGLAVVPFGAAHILMKMWTFGNFWCEFWTSIDVLCVTAS
IETLCVIAVDRYFAITSPFKYQSLLTKNKARVIILMVWIVSGLTSFLPIQMHWYRATHQE
AINCYANETCCDFFTNQAYAIASSIVSFYVPLVIMVFVYSRVFQEAKRQLQKIDKSEGRF
HVQNLSQVEQDGRTGHGLRRSSKFCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIQD
NLIRKEVYILLNWIGYVNSGFNPLIYCRSPDFRIAFQELLCLRRSSLKAYGNGYSSNGNT
GEQSGYHVEQEKENKLLCEDLPGTEDFVGHQGTVPSDNIDSQGRNCSTNDSLL
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggggcaacccgggaacggcagcgccttcttgctggcacccaatagaagccatgcgccg
gaccacgacgtcacgcagcaaagggacgaggtgtgggtggtgggcatgggcatcgtcatg
tctctcatcgtcctggccatcgtgtttggcaatgtgctggtcatcacagccattgccaag
ttcgagcgtctgcagacggtcaccaactacttcatcacttcactggcctgtgctgatctg
gtcatgggcctggcagtggtgccctttggggccgcccatattcttatgaaaatgtggact
tttggcaacttctggtgcgagttttggacttccattgatgtgctgtgcgtcacggccagc
attgagaccctgtgcgtgatcgcagtggatcgctactttgccattacttcacctttcaag
taccagagcctgctgaccaagaataaggcccgggtgatcattctgatggtgtggattgtg
tcaggccttacctccttcttgcccattcagatgcactggtaccgggccacccaccaggaa
gccatcaactgctatgccaatgagacctgctgtgacttcttcacgaaccaagcctatgcc
attgcctcttccatcgtgtccttctacgttcccctggtgatcatggtcttcgtctactcc
agggtctttcaggaggccaaaaggcagctccagaagattgacaaatctgagggccgcttc
catgtccagaaccttagccaggtggagcaggatgggcggacggggcatggactccgcaga
tcttccaagttctgcttgaaggagcacaaagccctcaagacgttaggcatcatcatgggc
actttcaccctctgctggctgcccttcttcatcgttaacattgtgcatgtgatccaggat
aacctcatccgtaaggaagtttacatcctcctaaattggataggctatgtcaattctggt
ttcaatccccttatctactgccggagcccagatttcaggattgccttccaggagcttctg
tgcctgcgcaggtcttctttgaaggcctatgggaatggctactccagcaacggcaacaca
ggggagcagagtggatatcacgtggaacaggagaaagaaaataaactgctgtgtgaagac
ctcccaggcacggaagactttgtgggccatcaaggtactgtgcctagcgataacattgat
tcacaagggaggaattgtagtacaaatgactcactgctgtaa

DBGET integrated database retrieval system