KEGG   Homo sapiens (human): 154091
Entry
154091            CDS       T01001                                 

Symbol
SLC2A12, GLUT12, GLUT8
Name
(RefSeq) solute carrier family 2 member 12
  KO
K08149  MFS transporter, SP family, solute carrier family 2 (facilitated glucose transporter), member 12
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    154091 (SLC2A12)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC2: Facilitative GLUT transporter
   154091 (SLC2A12)
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    154091 (SLC2A12)
SSDB
Motif
Pfam: Sugar_tr MFS_1
Other DBs
NCBI-GeneID: 154091
NCBI-ProteinID: NP_660159
OMIM: 610372
HGNC: 18067
Ensembl: ENSG00000146411
Vega: OTTHUMG00000015611
Pharos: Q8TD20(Tbio)
UniProt: Q8TD20
Position
6q23.2
AA seq 617 aa
MVPVENTEGPSLLNQKGTAVETEGSGSRHPPWARGCGMFTFLSSVTAAVSGLLVGYELGI
ISGALLQIKTLLALSCHEQEMVVSSLVIGALLASLTGGVLIDRYGRRTAIILSSCLLGLG
SLVLILSLSYTVLIVGRIAIGVSISLSSIATCVYIAEIAPQHRRGLLVSLNELMIVIGIL
SAYISNYAFANVFHGWKYMFGLVIPLGVLQAIAMYFLPPSPRFLVMKGQEGAASKVLGRL
RALSDTTEELTVIKSSLKDEYQYSFWDLFRSKDNMRTRIMIGLTLVFFVQITGQPNILFY
ASTVLKSVGFQSNEAASLASTGVGVVKVISTIPATLLVDHVGSKTFLCIGSSVMAASLVT
MGIVNLNIHMNFTHICRSHNSINQSLDESVIYGPGNLSTNNNTLRDHFKGISSHSRSSLM
PLRNDVDKRGETTSASLLNAGLSHTEYQIVTDPGDVPAFLKWLSLASLLVYVAAFSIGLG
PMPWLVLSEIFPGGIRGRAMALTSSMNWGINLLISLTFLTVTDLIGLPWVCFIYTIMSLA
SLLFVVMFIPETKGCSLEQISMELAKVNYVKNNICFMSHHQEELVPKQPQKRKPQEQLLE
CNKLCGRGQSRQLSPET
NT seq 1854 nt   +upstreamnt  +downstreamnt
atggtacctgttgaaaacaccgagggccccagtctgctgaaccagaaggggacagccgtg
gagacggagggcagcggcagccggcatcctccctgggcgagaggctgcggcatgtttacc
ttcctgtcatctgtcactgctgctgtcagtggcctcctggtgggttatgaacttgggatc
atctctggggctcttcttcagatcaaaaccttattagccctgagctgccatgagcaggaa
atggttgtgagctccctcgtcattggagccctccttgcctcactcaccggaggggtcctg
atagacagatatggaagaaggacagcaatcatcttgtcatcctgcctgcttggactcgga
agcttagtcttgatcctcagtttatcctacacggttcttatagtgggacgcattgccata
ggggtctccatctccctctcttccattgccacttgtgtttacatcgcagagattgctcct
caacacagaagaggccttcttgtgtcactgaatgagctgatgattgtcatcggcattctt
tctgcctatatttcaaattacgcatttgccaatgttttccatggctggaagtacatgttt
ggtcttgtgattcccttgggagttttgcaagcaattgcaatgtattttcttcctccaagc
cctcggtttctggtgatgaaaggacaagagggagctgctagcaaggttcttggaaggtta
agagcactctcagatacaactgaggaactcactgtgatcaaatcctccctgaaagatgaa
tatcagtacagtttttgggatctgtttcgttcaaaagacaacatgcggacccgaataatg
ataggactaacactagtattttttgtacaaatcactggccaaccaaacatattgttctat
gcatcaactgttttgaagtcagttggatttcaaagcaatgaggcagctagcctcgcctcc
actggggttggagtcgtcaaggtcattagcaccatccctgccactcttcttgtagaccat
gtcggcagcaaaacattcctctgcattggctcctctgtgatggcagcttcgttggtgacc
atgggcatcgtaaatctcaacatccacatgaacttcacccatatctgcagaagccacaat
tctatcaaccagtccttggatgagtctgtgatttatggaccaggaaacctgtcaaccaac
aacaatactctcagagaccacttcaaagggatttcttcccatagcagaagctcactcatg
cccctgagaaatgatgtggataagagaggggagacgacctcagcatccttgctaaatgct
ggattaagccacactgaataccagatagtcacagaccctggggacgtcccagcttttttg
aaatggctgtccttagccagcttgcttgtttatgttgctgctttttcaattggtctagga
ccaatgccctggctggtgctcagcgagatctttcctggtgggatcagaggacgagccatg
gctttaacttctagcatgaactggggcatcaatctcctcatctcgctgacatttttgact
gtaactgatcttattggcctgccatgggtgtgctttatatatacaatcatgagtctagca
tccctgctttttgttgttatgtttatacctgagacaaagggatgctctttggaacaaata
tcaatggagctagcaaaagtgaactatgtgaaaaacaacatttgttttatgagtcatcac
caagaagaattagtgccaaaacagcctcaaaaaagaaaaccccaggagcagctcttggag
tgtaacaagctgtgtggtaggggccaatccaggcagctttctccagagacctaa

DBGET integrated database retrieval system