KEGG   Homo sapiens (human): 1545
Entry
1545              CDS       T01001                                 

Symbol
CYP1B1, ASGD6, CP1B, CYPIB1, GLC3A, P4501B1
Name
(RefSeq) cytochrome P450 family 1 subfamily B member 1
  KO
K07410  cytochrome P450 family 1 subfamily B1 [EC:1.14.14.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00140  Steroid hormone biosynthesis
hsa00380  Tryptophan metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa04913  Ovarian steroidogenesis
hsa05204  Chemical carcinogenesis - DNA adducts
hsa05206  MicroRNAs in cancer
hsa05207  Chemical carcinogenesis - receptor activation
hsa05208  Chemical carcinogenesis - reactive oxygen species
Network
nt06227  Nuclear receptor signaling
nt06250  DNA adduct formation
nt06251  CYP-mediated ROS formation
nt06360  Cushing syndrome
  Element
N00317  AhR signaling pathway
N01365  TCDD to Ahr signaling pathway
N01366  BaP to Ahr signaling pathway
N01367  PCB to Ahr signaling pathway
N01374  BaP to DNA adducts
N01401  Benzo[a]pyrenre to CYP-mediated metabolism
N01405  17beta-estradiol to CYP-mediated metabolism
Disease
H01159  Anterior segment dysgenesis
H01203  Primary congenital glaucoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    1545 (CYP1B1)
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    1545 (CYP1B1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    1545 (CYP1B1)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    1545 (CYP1B1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    1545 (CYP1B1)
   05204 Chemical carcinogenesis - DNA adducts
    1545 (CYP1B1)
   05207 Chemical carcinogenesis - receptor activation
    1545 (CYP1B1)
   05208 Chemical carcinogenesis - reactive oxygen species
    1545 (CYP1B1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:hsa00199]
    1545 (CYP1B1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     1545 (CYP1B1)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP1 family
   1545 (CYP1B1)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 1545
NCBI-ProteinID: NP_000095
OMIM: 601771
HGNC: 2597
Ensembl: ENSG00000138061
Vega: OTTHUMG00000100970
Pharos: Q16678(Tchem)
UniProt: Q16678 Q53TK1
Structure
PDB: 
3PM0 6IQ5

Position
2p22.2
AA seq 543 aa
MGTSLSPNDPWPLNPLSIQQTTLLLLLSVLATVHVGQRLLRQRRRQLRSAPPGPFAWPLI
GNAAAVGQAAHLSFARLARRYGDVFQIRLGSCPIVVLNGERAIHQALVQQGSAFADRPAF
ASFRVVSGGRSMAFGHYSEHWKVQRRAAHSMMRNFFTRQPRSRQVLEGHVLSEARELVAL
LVRGSADGAFLDPRPLTVVAVANVMSAVCFGCRYSHDDPEFRELLSHNEEFGRTVGAGSL
VDVMPWLQYFPNPVRTVFREFEQLNRNFSNFILDKFLRHCESLRPGAAPRDMMDAFILSA
EKKAAGDSHGGGARLDLENVPATITDIFGASQDTLSTALQWLLLLFTRYPDVQTRVQAEL
DQVVGRDRLPCMGDQPNLPYVLAFLYEAMRFSSFVPVTIPHATTANTSVLGYHIPKDTVV
FVNQWSVNHDPLKWPNPENFDPARFLDKDGLINKDLTSRVMIFSVGKRRCIGEELSKMQL
FLFISILAHQCDFRANPNEPAKMNFSYGLTIKPKSFKVNVTLRESMELLDSAVQNLQAKE
TCQ
NT seq 1632 nt   +upstreamnt  +downstreamnt
atgggcaccagcctcagcccgaacgacccttggccgctaaacccgctgtccatccagcag
accacgctcctgctactcctgtcggtgctggccactgtgcatgtgggccagcggctgctg
aggcaacggaggcggcagctccggtccgcgcccccgggcccgtttgcgtggccactgatc
ggaaacgcggcggcggtgggccaggcggctcacctctcgttcgctcgcctggcgcggcgc
tacggcgacgttttccagatccgcctgggcagctgccccatagtggtgctgaatggcgag
cgcgccatccaccaggccctggtgcagcagggctcggccttcgccgaccggccggccttc
gcctccttccgtgtggtgtccggcggccgcagcatggctttcggccactactcggagcac
tggaaggtgcagcggcgcgcagcccacagcatgatgcgcaacttcttcacgcgccagccg
cgcagccgccaagtcctcgagggccacgtgctgagcgaggcgcgcgagctggtggcgctg
ctggtgcgcggcagcgcggacggcgccttcctcgacccgaggccgctgaccgtcgtggcc
gtggccaacgtcatgagtgccgtgtgtttcggctgccgctacagccacgacgaccccgag
ttccgtgagctgctcagccacaacgaagagttcgggcgcacggtgggcgcgggcagcctg
gtggacgtgatgccctggctgcagtacttccccaacccggtgcgcaccgttttccgcgaa
ttcgagcagctcaaccgcaacttcagcaacttcatcctggacaagttcttgaggcactgc
gaaagccttcggcccggggccgccccccgcgacatgatggacgcctttatcctctctgcg
gaaaagaaggcggccggggactcgcacggtggtggcgcgcggctggatttggagaacgta
ccggccactatcactgacatcttcggcgccagccaggacaccctgtccaccgcgctgcag
tggctgctcctcctcttcaccaggtatcctgatgtgcagactcgagtgcaggcagaattg
gatcaggtcgtggggagggaccgtctgccttgtatgggtgaccagcccaacctgccctat
gtcctggccttcctttatgaagccatgcgcttctccagctttgtgcctgtcactattcct
catgccaccactgccaacacctctgtcttgggctaccacattcccaaggacactgtggtt
tttgtcaaccagtggtctgtgaatcatgacccactgaagtggcctaacccggagaacttt
gatccagctcgattcttggacaaggatggcctcatcaacaaggacctgaccagcagagtg
atgattttttcagtgggcaaaaggcggtgcattggcgaagaactttctaagatgcagctt
tttctcttcatctccatcctggctcaccagtgcgatttcagggccaacccaaatgagcct
gcgaaaatgaatttcagttatggtctaaccattaaacccaagtcatttaaagtcaatgtc
actctcagagagtccatggagctccttgatagtgctgtccaaaatttacaagccaaggaa
acttgccaataa

DBGET integrated database retrieval system