KEGG   Homo sapiens (human): 1545Help
Entry
1545              CDS       T01001                                 

Gene name
CYP1B1, ASGD6, CP1B, CYPIB1, GLC3A, P4501B1
Definition
(RefSeq) cytochrome P450 family 1 subfamily B member 1
  KO
K07410  cytochrome P450 family 1 subfamily B polypeptide 1 [EC:1.14.14.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00140  Steroid hormone biosynthesis
hsa00380  Tryptophan metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa04913  Ovarian steroidogenesis
hsa05204  Chemical carcinogenesis
hsa05206  MicroRNAs in cancer
Disease
H00612  Primary open angle glaucoma
H01075  Peters anomaly
H01159  Anterior segment dysgenesis
H01203  Primary congenital glaucoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    1545 (CYP1B1)
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    1545 (CYP1B1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    1545 (CYP1B1)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    1545 (CYP1B1)
 09160 Human Diseases
  09161 Cancers: Overview
   05206 MicroRNAs in cancer
    1545 (CYP1B1)
   05204 Chemical carcinogenesis
    1545 (CYP1B1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:hsa00199]
    1545 (CYP1B1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     1545 (CYP1B1)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP1 family
   1545 (CYP1B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 1545
NCBI-ProteinID: NP_000095
OMIM: 601771
HGNC: 2597
Ensembl: ENSG00000138061
Vega: OTTHUMG00000100970
Pharos: Q16678(Tchem)
UniProt: Q16678 Q53TK1
Structure
PDB: 

Position
2p22.2
AA seq 543 aa AA seqDB search
MGTSLSPNDPWPLNPLSIQQTTLLLLLSVLATVHVGQRLLRQRRRQLRSAPPGPFAWPLI
GNAAAVGQAAHLSFARLARRYGDVFQIRLGSCPIVVLNGERAIHQALVQQGSAFADRPAF
ASFRVVSGGRSMAFGHYSEHWKVQRRAAHSMMRNFFTRQPRSRQVLEGHVLSEARELVAL
LVRGSADGAFLDPRPLTVVAVANVMSAVCFGCRYSHDDPEFRELLSHNEEFGRTVGAGSL
VDVMPWLQYFPNPVRTVFREFEQLNRNFSNFILDKFLRHCESLRPGAAPRDMMDAFILSA
EKKAAGDSHGGGARLDLENVPATITDIFGASQDTLSTALQWLLLLFTRYPDVQTRVQAEL
DQVVGRDRLPCMGDQPNLPYVLAFLYEAMRFSSFVPVTIPHATTANTSVLGYHIPKDTVV
FVNQWSVNHDPLKWPNPENFDPARFLDKDGLINKDLTSRVMIFSVGKRRCIGEELSKMQL
FLFISILAHQCDFRANPNEPAKMNFSYGLTIKPKSFKVNVTLRESMELLDSAVQNLQAKE
TCQ
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgggcaccagcctcagcccgaacgacccttggccgctaaacccgctgtccatccagcag
accacgctcctgctactcctgtcggtgctggccactgtgcatgtgggccagcggctgctg
aggcaacggaggcggcagctccggtccgcgcccccgggcccgtttgcgtggccactgatc
ggaaacgcggcggcggtgggccaggcggctcacctctcgttcgctcgcctggcgcggcgc
tacggcgacgttttccagatccgcctgggcagctgccccatagtggtgctgaatggcgag
cgcgccatccaccaggccctggtgcagcagggctcggccttcgccgaccggccggccttc
gcctccttccgtgtggtgtccggcggccgcagcatggctttcggccactactcggagcac
tggaaggtgcagcggcgcgcagcccacagcatgatgcgcaacttcttcacgcgccagccg
cgcagccgccaagtcctcgagggccacgtgctgagcgaggcgcgcgagctggtggcgctg
ctggtgcgcggcagcgcggacggcgccttcctcgacccgaggccgctgaccgtcgtggcc
gtggccaacgtcatgagtgccgtgtgtttcggctgccgctacagccacgacgaccccgag
ttccgtgagctgctcagccacaacgaagagttcgggcgcacggtgggcgcgggcagcctg
gtggacgtgatgccctggctgcagtacttccccaacccggtgcgcaccgttttccgcgaa
ttcgagcagctcaaccgcaacttcagcaacttcatcctggacaagttcttgaggcactgc
gaaagccttcggcccggggccgccccccgcgacatgatggacgcctttatcctctctgcg
gaaaagaaggcggccggggactcgcacggtggtggcgcgcggctggatttggagaacgta
ccggccactatcactgacatcttcggcgccagccaggacaccctgtccaccgcgctgcag
tggctgctcctcctcttcaccaggtatcctgatgtgcagactcgagtgcaggcagaattg
gatcaggtcgtggggagggaccgtctgccttgtatgggtgaccagcccaacctgccctat
gtcctggccttcctttatgaagccatgcgcttctccagctttgtgcctgtcactattcct
catgccaccactgccaacacctctgtcttgggctaccacattcccaaggacactgtggtt
tttgtcaaccagtggtctgtgaatcatgacccactgaagtggcctaacccggagaacttt
gatccagctcgattcttggacaaggatggcctcatcaacaaggacctgaccagcagagtg
atgattttttcagtgggcaaaaggcggtgcattggcgaagaactttctaagatgcagctt
tttctcttcatctccatcctggctcaccagtgcgatttcagggccaacccaaatgagcct
gcgaaaatgaatttcagttatggtctaaccattaaacccaagtcatttaaagtcaatgtc
actctcagagagtccatggagctccttgatagtgctgtccaaaatttacaagccaaggaa
acttgccaataa

DBGET integrated database retrieval system