KEGG   Homo sapiens (human): 154796Help
Entry
154796            CDS       T01001                                 

Gene name
AMOT
Definition
(RefSeq) angiomotin
  KO
K16819  angiomotin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04390  Hippo signaling pathway
hsa04530  Tight junction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    154796 (AMOT)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    154796 (AMOT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Angiomotin_C DUF2162
Motif
Other DBs
NCBI-GeneID: 154796
NCBI-ProteinID: NP_001106962
OMIM: 300410
HGNC: 17810
Ensembl: ENSG00000126016
Vega: OTTHUMG00000022216
Pharos: Q4VCS5(Tbio)
UniProt: Q4VCS5
Position
Xq23
AA seq 1084 aa AA seqDB search
MRNSEEQPSGGTTVLQRLLQEQLRYGNPSENRSLLAIHQQATGNGPPFPSGSGNPGPQSD
VLSPQDHHQQLVAHAARQEPQGQEIQSENLIMEKQLSPRMQNNEELPTYEEAKVQSQYFR
GQQHASVGAAFYVTGVTNQKMRTEGRPSVQRLNPGKMHQDEGLRDLKQGHVRSLSERLMQ
MSLATSGVKAHPPVTSAPLSPPQPNDLYKNPTSSSEFYKAQGPLPNQHSLKGMEHRGPPP
EYPFKGMPPQSVVCKPQEPGHFYSEHRLNQPGRTEGQLMRYQHPPEYGAARPAQDISLPL
SARNSQPHSPTSSLTSGGSLPLLQSPPSTRLSPARHPLVPNQGDHSAHLPRPQQHFLPNQ
AHQGDHYRLSQPGLSQQQQQQQQQHHHHHHHQQQQQQQPQQQPGEAYSAMPRAQPSSASY
QPVPADPFAIVSRAQQMVEILSDENRNLRQELEGCYEKVARLQKVETEIQRVSEAYENLV
KSSSKREALEKAMRNKLEGEIRRMHDFNRDLRERLETANKQLAEKEYEGSEDTRKTISQL
FAKNKESQREKEKLEAELATARSTNEDQRRHIEIRDQALSNAQAKVVKLEEELKKKQVYV
DKVEKMQQALVQLQAACEKREQLEHRLRTRLERELESLRIQQRQGNCQPTNVSEYNAAAL
MELLREKEERILALEADMTKWEQKYLEENVMRHFALDAAATVAAQRDTTVISHSPNTSYD
TALEARIQKEEEEILMANKRCLDMEGRIKTLHAQIIEKDAMIKVLQQRSRKEPSKTEQLS
CMRPAKSLMSISNAGSGLLSHSSTLTGSPIMEEKRDDKSWKGSLGILLGGDYRAEYVPST
PSPVPPSTPLLSAHSKTGSRDCSTQTERGTESNKTAAVAPISVPAPVAAAATAAAITATA
ATITTTMVAAAPVAVAAAAAPAAAAAPSPATAAATAAAVSPAAAGQIPAAASVASAAAVA
PSAAAAAAVQVAPAAPAPVPAPALVPVPAPAAAQASAPAQTQAPTSAPAVAPTPAPTPTP
AVAQAEVPASPATGPGPHRLSIPSLTCNPDKTDGPVFHSNTLERKTPIQILGQEPDAEMV
EYLI
NT seq 3255 nt NT seq  +upstreamnt  +downstreamnt
atgagaaattctgaagaacagccaagtggagggaccacggtattgcagcgtttgctacaa
gagcagcttcgctatggcaatcctagtgagaatcgcagcctgcttgccatacaccagcaa
gccacagggaatggccctcctttccccagtggcagtgggaacccgggccctcagagtgat
gtgttgagtccccaagaccaccaccaacagcttgtggctcatgctgctcgacaagaaccc
caggggcaggaaatccagtcagaaaacctcatcatggagaagcagctgtctcctcgaatg
caaaataatgaagaactcccgacctatgaagaagccaaggtccagtcccagtactttcgg
ggccaacagcatgccagtgttggagctgccttctatgtcactggagtcaccaaccagaag
atgaggactgagggacgcccatcagttcagcggctcaatcctggaaagatgcaccaagat
gagggactcagagaccttaagcaagggcatgtccgttccttgagtgaacgactaatgcag
atgtcactggccaccagtggagttaaggcccatccacctgttaccagtgctcccctctcc
ccaccacaacccaatgacctctacaagaatcccacaagttccagtgaattctacaaggcc
caagggccacttcctaaccagcatagcctgaagggcatggaacaccgaggccccccacca
gaatatcccttcaagggcatgccaccccaatctgtagtgtgcaagccccaagagccaggg
cacttctatagtgagcatcgcctgaaccagccagggagaacagaggggcaactgatgagg
tatcagcatccccctgagtatggagcagccaggccagcgcaggacatctcattgccattg
tcagccaggaactcgcagcctcacagccctacttcttctctgacctctggggggtccttg
cccttgctacaatctccaccatccactagattgtctcctgcccgacaccccttggtccca
aaccagggagaccattcagctcacctgcctaggccgcagcagcatttccttcctaatcag
gctcaccagggggatcattaccgtctctcccaacctggcctgagtcagcagcagcagcaa
cagcagcagcagcaccatcatcaccatcaccaccaacaacagcagcagcagcagccacag
cagcagccaggagaagcctattcagctatgcctcgggctcagccatcctctgcttcttat
cagccagtgccagcagacccttttgccattgtttccagagcccagcagatggttgagatc
ctctcagacgagaaccggaacttgaggcaagagttggaaggatgctatgagaaggtggca
agactgcagaaggtggagacagaaatccagcgcgtctcggaggcatatgagaacctcgtg
aagtcatcctccaaaagagaggccctagagaaagccatgagaaacaagctagagggcgag
attcggaggatgcatgatttcaacagggatctgagagagcgtctagagactgccaacaag
cagcttgcagagaaggaatatgaggggtcagaggacaccagaaaaaccatctcgcagctc
tttgcaaaaaataaagaaagccagcgtgagaaggagaagctggaagcggagctggccact
gcccgttctaccaatgaggaccaaagacgacacatcgaaatccgagatcaggccctgagt
aatgcccaggccaaggtggtaaagctggaagaagagctgaaaaagaagcaagtgtacgtt
gacaaggtggagaagatgcagcaggcccttgtacagctccaggcagcatgtgaaaaacgt
gagcagctagagcaccgtctccggacacgactggagagggaactggaatccctgagaatc
cagcagcgtcagggcaactgtcagcccaccaacgtttcagaatacaatgctgctgcactg
atggagctccttcgggagaaagaggagaggattctggctctggaagctgatatgacaaag
tgggagcagaaatatttggaggagaatgtgatgagacattttgctctggatgctgctgca
actgtggctgctcagagggacacaacagtcatcagtcactctcctaacaccagctatgac
acagctctagaagctcgcatccagaaagaggaggaagaaatcttgatggccaataagcgt
tgccttgacatggagggcaggattaagaccctccatgcccagattattgagaaggatgcc
atgatcaaagtactccagcagcgttcccggaaggagccgagcaagacagagcagctgtcg
tgcatgcggccagcgaagtctctgatgtccatttccaatgctggatcaggcttgctctcc
cactcatccaccctgactggctcccccatcatggaagaaaagcgagacgacaagagctgg
aaggggagcctaggcattctcctgggtggagactaccgtgctgaatatgtcccttccaca
ccctcgcctgtgccaccctcgactcccctgctctcggctcactccaagacaggcagccga
gactgcagtacccaaactgaacgtgggacggaatcgaacaaaactgcagctgttgctccc
atctctgttcctgctccagttgctgctgccgccactgctgccgccatcactgccactgct
gccaccatcaccaccaccatggtagctgctgctccagttgctgttgctgctgctgctgct
ccagctgctgctgctgccccgtctccagccactgccgctgctactgctgctgctgtttct
ccagctgctgctggtcagattccagctgctgcctctgttgcctcagctgctgccgttgct
ccttctgctgctgctgctgctgctgttcaggttgctccagctgctccggctccagttcca
gctccggctctggttccggttccagctccagcagcggctcaggcttctgctcctgctcag
actcaggcaccaacttcagctccggctgtggctccaactccagctccaactccaactcca
gctgtggctcaggctgaggttcctgcaagtccagctaccggtcctggaccacatcgtttg
tctataccaagtttgacctgcaatccagacaaaacagatgggcctgtgttccactccaat
actctggaaagaaaaactcccattcagatcctgggacaagagcctgatgcagagatggtg
gaatatctcatctaa

DBGET integrated database retrieval system