KEGG   Homo sapiens (human): 1548Help
Entry
1548              CDS       T01001                                 

Gene name
CYP2A6, CPA6, CYP2A, CYP2A3, CYPIIA6, P450C2A, P450PB
Definition
(RefSeq) cytochrome P450 family 2 subfamily A member 6
  KO
K17683  cytochrome P450 family 2 subfamily A polypeptide 6 [EC:1.14.13.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00232  Caffeine metabolism
hsa00830  Retinol metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa05204  Chemical carcinogenesis
Disease
H01205  Coumarin resistance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    1548 (CYP2A6)
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    1548 (CYP2A6)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    1548 (CYP2A6)
   00982 Drug metabolism - cytochrome P450
    1548 (CYP2A6)
   00983 Drug metabolism - other enzymes
    1548 (CYP2A6)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    1548 (CYP2A6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:hsa00199]
    1548 (CYP2A6)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.-  
     1548 (CYP2A6)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP2 family
   1548 (CYP2A6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 1548
NCBI-ProteinID: NP_000753
OMIM: 122720
HGNC: 2610
Ensembl: ENSG00000255974
Vega: OTTHUMG00000182713
Pharos: P11509(Tchem)
UniProt: P11509
Structure
PDB: 

Position
19q13.2
AA seq 494 aa AA seqDB search
MLASGMLLVALLVCLTVMVLMSVWQQRKSKGKLPPGPTPLPFIGNYLQLNTEQMYNSLMK
ISERYGPVFTIHLGPRRVVVLCGHDAVREALVDQAEEFSGRGEQATFDWVFKGYGVVFSN
GERAKQLRRFSIATLRDFGVGKRGIEERIQEEAGFLIDALRGTGGANIDPTFFLSRTVSN
VISSIVFGDRFDYKDKEFLSLLRMMLGIFQFTSTSTGQLYEMFSSVMKHLPGPQQQAFQL
LQGLEDFIAKKVEHNQRTLDPNSPRDFIDSFLIRMQEEEKNPNTEFYLKNLVMTTLNLFI
GGTETVSTTLRYGFLLLMKHPEVEAKVHEEIDRVIGKNRQPKFEDRAKMPYMEAVIHEIQ
RFGDVIPMSLARRVKKDTKFRDFFLPKGTEVYPMLGSVLRDPSFFSNPQDFNPQHFLNEK
GQFKKSDAFVPFSIGKRNCFGEGLARMELFLFFTTVMQNFRLKSSQSPKDIDVSPKHVGF
ATIPRNYTMSFLPR
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgctggcctcagggatgcttctggtggccttgctggtctgcctgactgtaatggtcttg
atgtctgtttggcagcagaggaagagcaaggggaagctgcctccgggacccaccccattg
cccttcattggaaactacctgcagctgaacacagagcagatgtacaactccctcatgaag
atcagtgagcgctatggccccgtgttcaccattcacttggggccccggcgggtcgtggtg
ctgtgtggacatgatgccgtcagggaggctctggtggaccaggctgaggagttcagcggg
cgaggcgagcaagccaccttcgactgggtcttcaaaggctatggcgtggtattcagcaac
ggggagcgcgccaagcagctccggcgcttctccatcgccaccctgcgggacttcggggtg
ggcaagcgaggcatcgaggagcgcatccaggaggaggcgggcttcctcatcgacgccctc
cggggcactggcggcgccaatatcgatcccaccttcttcctgagccgcacagtctccaat
gtcatcagctccattgtctttggggaccgctttgactataaggacaaagagttcctgtca
ctgttgcgcatgatgctaggaatcttccagttcacgtcaacctccacggggcagctctat
gagatgttctcttcggtgatgaaacacctgccaggaccacagcaacaggcctttcagttg
ctgcaagggctggaggacttcatagccaagaaggtggagcacaaccagcgcacgctggat
cccaattccccacgggacttcattgactcctttctcatccgcatgcaggaggaggagaag
aaccccaacacggagttctacttgaaaaacctggtgatgaccacgttgaacctcttcatt
gggggcaccgagaccgtcagcaccaccctgcgctatggcttcttgctgctcatgaagcac
ccagaggtggaggccaaggtccatgaggagattgacagagtgatcggcaagaaccggcag
cccaagtttgaggaccgggccaagatgccctacatggaggcagtgatccacgagatccaa
agatttggagacgtgatccccatgagtttggcccgcagagtcaaaaaggacaccaagttt
cgggatttcttcctccctaagggcaccgaagtgtaccctatgctgggctctgtgctgaga
gaccccagtttcttctccaacccccaggacttcaatccccagcacttcctgaatgagaag
gggcagtttaagaagagtgatgcttttgtgcccttttccatcggaaagcggaactgtttc
ggagaaggcctggccagaatggagctctttctcttcttcaccaccgtcatgcagaacttc
cgcctcaagtcctcccagtcacctaaggacattgacgtgtcccccaaacacgtgggcttt
gccacgatcccacgaaactacaccatgagcttcctgccccgctga

DBGET integrated database retrieval system