KEGG   Homo sapiens (human): 154865Help
Entry
154865            CDS       T01001                                 

Gene name
IQUB
Definition
(RefSeq) IQ motif and ubiquitin domain containing
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: ubiquitin DUF4041 Rad60-SLD Stc1
Motif
Other DBs
NCBI-GeneID: 154865
NCBI-ProteinID: NP_001269784
HGNC: 21995
Ensembl: ENSG00000164675
Vega: OTTHUMG00000157347
Pharos: Q8NA54(Tdark)
UniProt: Q8NA54 A0A024R771
Structure
PDB: 

Position
7q31.32
AA seq 791 aa AA seqDB search
MSNQQEKYEAQNIVNSTEESDDAFDTVTIPVPSEEPQESDQTEEHESGIEQFSESHAIHV
EEQSDQSFSSLEPDNEQLMEEVISPRQVSYTPQHHEKQYAMQRPNDDSLAFLDKIKSVKE
SLQESVEDSLATVKVVLIPVGQEIVIPFKVDTILKYLKDHFSHLLGIPHSVLQIRYSGKI
LKNNETLVQHGVKPQEIVQVEIFSTNPDLYPVRRIDGLTDVSQIITVTVQTGLDQYQQVP
VEIVKSDFHKPFLGGFRHKVTGVEYHNAGTQTVPKRIPERLSIFCRDTQTVFQKKNLQQT
TNTTSTQMTNIGVYVSNMTDKLVTPGKYFSAAEYHAQRLKAVIVIQTYYRQWHAKIFVEN
LRRQKSLRLEWETQQELRKIREKEEWIKLDYHRRHNPKTNEDFEFLYNALEFWRQEELTR
INQSFTGAERKAALCELLEKETQIIASIGRHRYIAYMANQEAAIQAFLDKCSAPKIWRTP
NGKTIEMDTQFTIRARELQNIYKCIMLKNISQDERLDVLLTLKHTVKEHECKLTQEILEL
IDREVDLMMRGVKHHNLEGLRKRIATLFFHYIKTPLFNPEVAKYLKVPQDPLKFYKKIYF
CHSCQLYLPSTEFSVSSTSRRIYRCRNCINLQNEAQKRESFLKYKCLLQQLYYTEADYED
DSKIAFLMQLQDIQYLTENIWASQSVLSACDNLSDLVMVRWNKSLEWSPWNCILLTKDEA
AAHLKLTSIEEGYERSFIHKIKHKHILAKNYFSQVPVLASFILDDGEIDEIRWKYHSDTT
PKIIESQRPPH
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atgtctaatcaacaggagaagtatgaagctcagaatatagtcaattcaacagaagagagt
gatgatgcttttgatactgtcactattccagttccctcagaagagcctcaagagtcagat
caaactgaagagcatgaatctggaatagaacaattcagtgagagccatgcaatacatgtt
gaggagcagagtgaccaaagcttttcaagcctggaaccagacaatgaacaactcatggaa
gaggttatatcaccaagacaagtttcatatactccgcaacatcatgaaaagcaatatgca
atgcagaggccaaatgatgatagtttggcatttctggataaaataaagtctgtaaaggaa
tctttgcaagaatcagtggaagattctctagcaacagtaaaagttgtacttattccagtg
ggccaggaaattgtaataccttttaaggttgataccattcttaaatatcttaaggaccat
ttttcacacttattaggtatcccacattctgtactgcagataagatactcaggaaaaatt
cttaaaaataatgagactctagtacaacatggagttaagccacaggaaattgtacaagtg
gaaatcttttctacaaatccagatctgtatccagtcagaagaatagatggattaactgat
gtctctcaaatcataactgtcactgtccaaactggacttgatcaataccagcaggtacct
gttgagattgtcaaatctgactttcacaaaccatttcttggtggattcagacataaagta
acaggagtagagtatcacaatgctggaacacaaactgtacctaaaaggattcccgaaaga
ctcagtatattttgtagggatacgcagacagtttttcagaaaaaaaatctccaacaaact
acaaatacaacatccacacagatgactaacattggtgtatatgtatcaaatatgactgat
aaactggtaacaccaggaaagtatttttcagcagcagaataccatgctcaaagactaaag
gcggtgatagtgatacagacttactacaggcaatggcatgctaaaatcttcgtagagaat
ttaagaagacagaaaagcttaagactggaatgggaaacacagcaagaactaaggaagata
agagaaaaagaagaatggataaaattggactatcaccggaggcataatcctaaaacaaat
gaagattttgaatttctttataatgcattagaattctggcggcaagaagaacttacacgt
attaaccaatcttttactggagctgaaaggaaagctgctctgtgtgaacttctggaaaaa
gagactcagataattgcttccattgggagacatagatacattgcttatatggcaaatcag
gaagcagcaatacaagcttttttggataagtgttcagctccaaaaatatggagaacccct
aatggcaaaacaattgagatggatacgcagttcaccatcagagccagagagctgcaaaat
atctataagtgcattatgctgaaaaatatctcccaagatgagaggctggatgtgctgtta
actcttaaacacactgtaaaggaacatgaatgtaaactaactcaggaaattctagaattg
attgacagagaggttgaccttatgatgagaggagtcaaacatcataaccttgaaggactc
agaaaaagaattgcgacactcttttttcattatatcaaaacacctctgtttaatcctgaa
gttgcaaaataccttaaggtccctcaagacccattgaaattttataagaagatttacttt
tgccacagttgccagctttatttgccttctacagaattttctgtatcatccacctcacgc
cgcatataccggtgtcgtaactgcattaaccttcagaatgaggctcaaaaacgagaatca
tttttgaagtacaaatgtttacttcaacagctctactatacagaagctgattatgaagat
gattctaaaattgctttcttgatgcagctacaagacattcagtacctgacagagaacatc
tgggcgtcccagtcagtcctcagtgcttgcgacaatctcagtgatctggtcatggtcaga
tggaataaatccctggagtggtccccctggaactgcattcttcttaccaaagatgaagca
gctgctcatctcaagctaacaagtattgaagagggatatgaacgctcatttattcacaag
atcaaacacaaacatatcctggctaagaactatttttctcaggttccagtgctggcttca
tttatacttgatgatggtgaaattgatgagatcagatggaagtatcactcagacacaaca
cctaagattatagaatcccagaggcctcctcattag

DBGET integrated database retrieval system