KEGG   Homo sapiens (human): 155061Help
Entry
155061            CDS       T01001                                 

Gene name
ZNF746, PARIS
Definition
(RefSeq) zinc finger protein 746
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05168 Herpes simplex virus 1 infection
    155061 (ZNF746)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    155061 (ZNF746)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Other Cys2His2 zinc factors
    155061 (ZNF746)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 KRAB DUF3669 zf-C2H2_jaz zf-met zf-C2H2_6 zf-C2H2_11
Motif
Other DBs
NCBI-GeneID: 155061
NCBI-ProteinID: NP_689770
OMIM: 613914
HGNC: 21948
Ensembl: ENSG00000181220
Vega: OTTHUMG00000158972
Pharos: Q6NUN9(Tbio)
UniProt: Q6NUN9
Position
7q36.1
AA seq 644 aa AA seqDB search
MAEAVAAPISPWTMAATIQAMERKIESQAARLLSLEGRTGMAEKKLADCEKTAVEFGNQL
EGKWAVLGTLLQEYGLLQRRLENVENLLRNRNFWILRLPPGSKGESPKEWGKLEDWQKEL
YKHVMRGNYETLVSLDYAISKPEVLSQIEQGKEPCNWRRPGPKIPDVPVDPSPGSGPPVP
APDLLMQIKQEGELQLQEQQALGVEAWAAGQPDIGEEPWGLSQLDSGAGDISTDATSGVH
SNFSTTIPPTSWQTDLPPHHPSSACSDGTLKLNTAASTEDVKIVIKTEVQEEEVVATPVH
PTDLEAHGTLFGPGQATRFFPSPAQEGAWESQGSSFPSQDPVLGLREPARPERDMGELSP
AVAQEETPPGDWLFGGVRWGWNFRCKPPVGLNPRTGPEGLPYSSPDNGEAILDPSQAPRP
FNEPCKYPGRTKGFGHKPGLKKHPAAPPGGRPFTCATCGKSFQLQVSLSAHQRSCGAPDG
SGPGTGGGGSGSGGGGGGSGGGSARDGSALRCGECGRCFTRPAHLIRHRMLHTGERPFPC
TECEKRFTERSKLIDHYRTHTGVRPFTCTVCGKSFIRKDHLRKHQRNHAAGAKTPARGQP
LPTPPAPPDPFKSPASKGPLASTDLVTDWTCGLSVLGPTDGGDM
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggcggtcgcggctccgatttctccgtggacgatggcagccacgattcaggcc
atggagaggaagattgaatcgcaggctgctcgcctgctttccctagaaggtcgaaccggg
atggccgagaagaagctggctgattgcgagaagacagccgtggagttcgggaaccagctg
gagggcaagtgggccgtgctggggaccctgctgcaggagtacgggctgctgcagaggcgg
ctggagaacgtggagaacctgctgcgcaacaggaacttctggatcctgcggctgcccccg
ggcagcaagggggagtcccctaaggagtggggcaagctggaggactggcagaaggagctc
tacaagcacgtgatgaggggcaactacgagacgctggtctccctggactacgccatctcc
aagcccgaggtcctctcccagattgaacaagggaaggagccctgcaactggcgccgccct
ggccccaagattccagatgttcctgtggaccccagtccaggctcggggcccccagttccc
gccccagacctcttgatgcagatcaagcaggagggtgagctccagctccaggagcagcag
gccctgggcgtggaggcgtgggcagccgggcagccagatattggggaggagccctggggc
ctcagccagctggattccggagcaggagacatctccacggatgccacctctggtgtccat
tccaacttttccaccaccatcccgcccacctcctggcaaacggatctccctccccaccat
ccctcttcagcatgctcggacgggaccctgaagctcaacacagcagcctccacggaagat
gtaaaaattgtaataaaaacagaagtccaggaagaggaggtggtggccacacccgtacat
cctactgacctagaggctcacgggaccctgtttggaccaggccaagccacacggttcttc
cctagtcctgcccaggaaggagcctgggaaagccagggcagctccttccccagccaggac
cctgtgctggggctgcgagagcccgcccggcctgagagggacatgggtgagctcagtcct
gctgtggcccaggaggagacccctcctggggactggctcttcggaggggtccggtggggc
tggaatttccggtgtaaaccgccagtgggcctgaacccgaggacggggcccgaggggctt
ccttactcctccccggacaacggagaggccatcttggaccccagccaggccccaaggcca
ttcaacgaaccctgtaaataccctggccggaccaaaggctttggccacaagccagggctg
aagaagcaccccgcggcgccccccgggggccggcccttcacctgcgccacgtgtgggaag
agcttccagctgcaagtcagcctgagcgcgcaccagcgcagctgtggggcgcccgacggg
tcgggcccgggcacaggcggtggcggcagcggcagtggcggcggcggtggcggcagcggt
gggggcagcgcacgggatggcagcgcccttcggtgtggggagtgcggccgttgcttcacg
cgccccgcgcacctcatccgccatcgcatgctgcacaccggcgagcggcccttcccctgc
accgagtgtgagaagcgcttcaccgaacgctccaagctcatcgaccactaccgaacgcac
acgggcgtgcggcccttcacctgcaccgtctgcggcaaaagcttcatccgcaaggaccac
ctccgcaagcaccagcgcaaccatgcagcgggcgccaagaccccggcccgaggccagcca
ctcccgacgccgcccgcacctcctgatcccttcaagagccccgcctccaaaggacctttg
gcctccacagaccttgtgaccgactggacttgtggcctcagcgtcctgggacccaccgat
ggcggggacatgtga

DBGET integrated database retrieval system