KEGG   Homo sapiens (human): 155066Help
Entry
155066            CDS       T01001                                 

Gene name
ATP6V0E2, ATP6V0E2L, C7orf32
Definition
(RefSeq) ATPase H+ transporting V0 subunit e2
  KO
K02153  V-type H+-transporting ATPase subunit e
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04145  Phagosome
hsa04721  Synaptic vesicle cycle
hsa04966  Collecting duct acid secretion
hsa05110  Vibrio cholerae infection
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05323  Rheumatoid arthritis
Module
hsa_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    155066 (ATP6V0E2)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    155066 (ATP6V0E2)
 Organismal Systems
  Excretory system
   04966 Collecting duct acid secretion
    155066 (ATP6V0E2)
  Nervous system
   04721 Synaptic vesicle cycle
    155066 (ATP6V0E2)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    155066 (ATP6V0E2)
  Infectious diseases
   05110 Vibrio cholerae infection
    155066 (ATP6V0E2)
   05120 Epithelial cell signaling in Helicobacter pylori infection
    155066 (ATP6V0E2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP_synt_H DrsE_2 Far-17a_AIG1
Motif
Other DBs
NCBI-GeneID: 155066
NCBI-ProteinID: NP_660265
OMIM: 611019
HGNC: 21723
Ensembl: ENSG00000171130
Vega: OTTHUMG00000158094
Pharos: Q8NHE4(Tdark)
UniProt: Q8NHE4
Position
7q36.1
AA seq 130 aa AA seqDB search
MRVRGPARLIASGARLLLRMLSALPGWGPAHLQRPLLGPASCLGILRPAMTAHSFALPVI
IFTTFWGLVGIAGPWFVPKGPNRGVIITMLVATAVCCYLFWLIAILAQLNPLFGPQLKNE
TIWYVRFLWE
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtgcgcggcccggcccggctgatcgcttcgggtgctcgactcctgttgcgcatg
ctcagcgcgctgcccggctggggacccgcgcacctgcagcgcccgctgctcggccctgca
tcctgcctgggcatcctgcgcccggccatgacggcgcactcattcgccctcccggtcatc
atcttcaccacgttctggggcctcgtcggcatcgccgggccctggttcgtgccgaaggga
cccaaccgcggagtgatcatcaccatgctggtcgccaccgccgtctgctgttacctcttc
tggctcatcgccatcctggcgcagctgaaccccctgttcgggccccagctgaagaatgag
accatctggtacgtgcgcttcctgtgggagtga

DBGET integrated database retrieval system