KEGG   Homo sapiens (human): 155066
Entry
155066            CDS       T01001                                 
Symbol
ATP6V0E2, ATP6V0E2L, C7orf32
Name
(RefSeq) ATPase H+ transporting V0 subunit e2
  KO
K02153  V-type H+-transporting ATPase subunit e
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04145  Phagosome
hsa04721  Synaptic vesicle cycle
hsa04966  Collecting duct acid secretion
hsa05110  Vibrio cholerae infection
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05165  Human papillomavirus infection
hsa05323  Rheumatoid arthritis
Module
hsa_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    155066 (ATP6V0E2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    155066 (ATP6V0E2)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    155066 (ATP6V0E2)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    155066 (ATP6V0E2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    155066 (ATP6V0E2)
  09171 Infectious disease: bacterial
   05110 Vibrio cholerae infection
    155066 (ATP6V0E2)
   05120 Epithelial cell signaling in Helicobacter pylori infection
    155066 (ATP6V0E2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    155066 (ATP6V0E2)
SSDB
Motif
Pfam: ATP_synt_H DrsE_2 Far-17a_AIG1
Other DBs
NCBI-GeneID: 155066
NCBI-ProteinID: NP_660265
OMIM: 611019
HGNC: 21723
Ensembl: ENSG00000171130
Pharos: Q8NHE4(Tdark)
UniProt: Q8NHE4
Position
7:149872964..149880713
AA seq 81 aa
MTAHSFALPVIIFTTFWGLVGIAGPWFVPKGPNRGVIITMLVATAVCCYLFWLIAILAQL
NPLFGPQLKNETIWYVRFLWE
NT seq 246 nt   +upstreamnt  +downstreamnt
atgacggcgcactcattcgccctcccggtcatcatcttcaccacgttctggggcctcgtc
ggcatcgccgggccctggttcgtgccgaagggacccaaccgcggagtgatcatcaccatg
ctggtcgccaccgccgtctgctgttacctcttctggctcatcgccatcctggcgcagctg
aaccccctgttcgggccccagctgaagaatgagaccatctggtacgtgcgcttcctgtgg
gagtga

DBGET integrated database retrieval system