KEGG   Homo sapiens (human): 155184
Entry
155184            CDS       T01001                                 

Gene name
SLC2A7, GLUT-7, GLUT7, hGLUT7
Definition
(RefSeq) solute carrier family 2 member 7
  KO
K12201  MFS transporter, SP family, solute carrier family 2 (facilitated glucose/fructose transporter), member 7
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    155184 (SLC2A7)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC2: Facilitative GLUT transporter
   155184 (SLC2A7)
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    155184 (SLC2A7)
SSDB
Motif
Pfam: Sugar_tr MFS_1 RDD IBV_3C
Other DBs
NCBI-GeneID: 155184
NCBI-ProteinID: NP_997303
OMIM: 610371
HGNC: 13445
Ensembl: ENSG00000197241
Vega: OTTHUMG00000057499
Pharos: Q6PXP3(Tdark)
UniProt: Q6PXP3
Position
1p36.23
AA seq 512 aa
MENKEAGTPPPIPSREGRLQPTLLLATLSAAFGSAFQYGYNLSVVNTPHKVFKSFYNETY
FERHATFMDGKLMLLLWSCTVSMFPLGGLLGSLLVGLLVDSCGRKGTLLINNIFAIIPAI
LMGVSKVAKAFELIVFSRVVLGVCAGISYSALPMYLGELAPKNLRGMVGTMTEVFVIVGV
FLAQIFSLQAILGNPAGWPVLLALTGVPALLQLLTLPFFPESPRYSLIQKGDEATARQAL
RRLRGHTDMEAELEDMRAEARAERAEGHLSVLHLCALRSLRWQLLSIIVLMAGQQLSGIN
AINYYADTIYTSAGVEAAHSQYVTVGSGVVNIVMTITSAVLVERLGRRHLLLAGYGICGS
ACLVLTVVLLFQNRVPELSYLGIICVFAYIAGHSIGPSPVPSVVRTEIFLQSSRRAAFMV
DGAVHWLTNFIIGFLFPSIQEAIGAYSFIIFAGICLLTAIYIYVVIPETKGKTFVEINRI
FAKRNRVKLPEEKEETIDAGPPTASPAKETSF
NT seq 1539 nt   +upstreamnt  +downstreamnt
atggagaacaaagaggcgggaacccctccacccattccatccagggaggggcggctccag
ccgacgctgttgctggcgacactgagcgcggcctttggctcagccttccagtacggctac
aacctctctgtggtcaacacgccgcacaaggtcttcaagtcattttacaacgaaacctac
tttgagcgacacgcaacattcatggacgggaagctcatgctgcttctatggtcttgcacc
gtctccatgtttcctctgggcggcctgttggggtcattgctcgtgggcctgctggttgat
agctgcggcagaaaggggaccctgctgatcaacaacatctttgccatcatccccgccatc
ctgatgggagtcagcaaagtggccaaggcttttgagctgatcgtcttttcccgagtggtg
ctgggagtctgtgcaggcatctcctacagcgcccttcccatgtacctgggagaactggcc
cccaagaacctgagaggcatggtgggaacaatgaccgaggttttcgtcatcgttggagtc
ttcctagcacagatcttcagcctccaggccatcttgggcaacccggcaggctggccggtg
cttctggcgctcacaggggtgcccgccctgctgcagctgctgaccctgcccttcttcccc
gaaagcccccgctactccctgattcagaaaggagatgaagccacagcgcgacaagctctg
aggaggctgagaggccacacggacatggaggccgagctggaggacatgcgtgcggaggcc
cgggccgagcgcgccgagggccacctgtctgtgctgcacctctgtgccctgcggtccctg
cgctggcagctcctctccatcatcgtgctcatggccggccagcagctgtcgggcatcaat
gcgatcaactactatgcggacaccatctacacatctgcgggcgtggaggccgctcactcc
caatatgtaacggtgggctctggcgtcgtcaacatagtgatgaccatcacctcggctgtc
cttgtggagcggctgggacggcggcacctcctgctggccggctacggcatctgcggctct
gcctgcctggtgctgacggtggtgctcctattccagaacagggtccccgagctgtcctac
ctcggcatcatctgtgtctttgcctacatcgcgggacattccattgggcccagtcctgtc
ccctcggtggtgaggaccgagatcttcctgcagtcctcccggcgggcagctttcatggtg
gacggggcagtgcactggctcaccaacttcatcataggcttcctgttcccatccatccag
gaggccatcggtgcctacagtttcatcatctttgccggaatctgcctcctcactgcgatt
tacatctacgtggttattccggagaccaagggcaaaacatttgtggagataaaccgcatt
tttgccaagagaaacagggtgaagcttccagaggagaaagaagaaaccattgatgctggg
cctcccacagcctctcctgccaaggaaacttccttttag

DBGET integrated database retrieval system