KEGG   Homo sapiens (human): 1553
Entry
1553              CDS       T01001                                 
Symbol
CYP2A13, CPAD, CYP2A, CYPIIA13
Name
(RefSeq) cytochrome P450 family 2 subfamily A member 13
  KO
K17685  cytochrome P450 family 2 subfamily A13 [EC:1.14.14.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa05204  Chemical carcinogenesis - DNA adducts
Network
nt06250  DNA adduct formation
  Element
N01379  NNK to DNA adducts
N01380  NNK to DNA adducts
N01381  NNK to DNA adducts
N01382  NNK to DNA adducts
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    1553 (CYP2A13)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis - DNA adducts
    1553 (CYP2A13)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:hsa00199]
    1553 (CYP2A13)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     1553 (CYP2A13)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP2 family
   1553 (CYP2A13)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 1553
NCBI-ProteinID: NP_000757
OMIM: 608055
HGNC: 2608
Ensembl: ENSG00000197838
Pharos: Q16696(Tbio)
UniProt: Q16696
Structure
Position
19:41088451..41096195
AA seq 494 aa
MLASGLLLVTLLACLTVMVLMSVWRQRKSRGKLPPGPTPLPFIGNYLQLNTEQMYNSLMK
ISERYGPVFTIHLGPRRVVVLCGHDAVKEALVDQAEEFSGRGEQATFDWLFKGYGVAFSN
GERAKQLRRFSIATLRGFGVGKRGIEERIQEEAGFLIDALRGTHGANIDPTFFLSRTVSN
VISSIVFGDRFDYEDKEFLSLLRMMLGSFQFTATSTGQLYEMFSSVMKHLPGPQQQAFKE
LQGLEDFIAKKVEHNQRTLDPNSPRDFIDSFLIRMQEEEKNPNTEFYLKNLVMTTLNLFF
AGTETVSTTLRYGFLLLMKHPEVEAKVHEEIDRVIGKNRQPKFEDRAKMPYTEAVIHEIQ
RFGDMLPMGLAHRVNKDTKFRDFFLPKGTEVFPMLGSVLRDPRFFSNPRDFNPQHFLDKK
GQFKKSDAFVPFSIGKRYCFGEGLARMELFLFFTTIMQNFRFKSPQSPKDIDVSPKHVGF
ATIPRNYTMSFLPR
NT seq 1485 nt   +upstreamnt  +downstreamnt
atgctggcctcagggctgcttctggtgaccttgctggcctgcctgactgtgatggtcttg
atgtcagtctggcggcagaggaagagcagggggaagctgcctccgggacccaccccattg
cccttcattggaaactacctgcagctgaacacagagcagatgtacaactccctcatgaag
atcagtgagcgctatggccctgtgttcaccattcacttggggccccggcgggtcgtggtg
ctgtgcggacatgatgccgtcaaggaggctctggtggaccaggctgaggagttcagcggg
cgaggcgagcaggccaccttcgactggctcttcaaaggctatggcgtggcgttcagcaac
ggggagcgcgccaagcagctccggcgcttctccatcgccaccctaaggggttttggcgtg
ggcaagcgcggcatcgaggaacgcatccaggaggaggcgggcttcctcatcgacgccctc
cggggcacgcacggcgccaatatcgatcccaccttcttcctgagccgcacagtctccaat
gtcatcagctccattgtctttggggaccgctttgactatgaggacaaagagttcctgtca
ctgttgcgcatgatgctgggaagcttccagttcacggcaacctccacggggcagctctat
gagatgttctcttcggtgatgaaacacctgccaggaccacagcaacaggcctttaaggag
ctgcaagggctggaggacttcatcgccaagaaggtggagcacaaccagcgcacgctggat
cccaattccccacgggacttcatcgactcctttctcatccgcatgcaggaggaggagaag
aaccccaacacagagttctacttgaagaacctggtgatgaccaccctgaacctcttcttt
gcgggcactgagaccgtgagcaccaccctgcgctacggtttcctgctgctcatgaagcac
ccagaggtggaggccaaggtccatgaggagattgacagagtgatcggcaagaaccggcag
cccaagtttgaggaccgggccaagatgccctacacagaggcagtgatccacgagatccaa
agatttggagacatgctccccatgggtttggcccacagggtcaacaaggacaccaagttt
cgggatttcttcctccctaagggcactgaagtgttccctatgctgggctccgtgctgaga
gaccccaggttcttctccaacccccgggacttcaatccccagcacttcctggataagaag
gggcagtttaagaagagtgatgcttttgtgcccttttccatcggaaagcggtactgtttt
ggagaaggcctggccagaatggagctctttctcttcttcaccaccatcatgcagaacttt
cgcttcaagtcccctcagtcgcctaaggatatcgacgtgtcccccaaacacgtgggcttt
gccacgatcccacgaaactacaccatgagcttcctgccccgctga

DBGET integrated database retrieval system