KEGG   Homo sapiens (human): 155382Help
Entry
155382            CDS       T01001                                 

Gene name
VPS37D, WBSCR24
Definition
(RefSeq) VPS37D, ESCRT-I subunit
  KO
K12185  ESCRT-I complex subunit VPS37
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Module
hsa_M00409  ESCRT-I complex
Disease
H01439  Williams-Beuren syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    155382 (VPS37D)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    155382 (VPS37D)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    155382 (VPS37D)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-I complex
    155382 (VPS37D)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   155382 (VPS37D)
  Exosomal proteins of colorectal cancer cells
   155382 (VPS37D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mod_r
Motif
Other DBs
NCBI-GeneID: 155382
NCBI-ProteinID: NP_001071089
OMIM: 610039
HGNC: 18287
Ensembl: ENSG00000176428
Vega: OTTHUMG00000157227
Pharos: Q86XT2(Tdark)
UniProt: Q86XT2
Position
7q11.23
AA seq 251 aa AA seqDB search
MYRARAARAGPEPGSPGRFGILSTGQLRDLLQDEPKLDRIVRLSRKFQGLQLEREACLAS
NYALAKENLALRPRLEMGRAALAIKYQELREVAENCADKLQRLEESMHRWSPHCALGWLQ
AELEEAEQEAEEQMEQLLLGEQSLEAFLPAFQRGRALAHLRRTQAEKLQELLRRRERSAQ
PAPTSAADPPKSFPAAAVLPTGAARGPPAVPRSLPPLDSRPVPPLKGSPGCPLGPAPLLS
PRPSQPEPPHR
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgtaccgggcccgggcggcgcgggcggggccggagcccggcagcccggggcgctttggg
atcctcagcaccgggcagctccgggacctgcttcaggatgagcccaagctggaccggatc
gtgcggctcagcaggaagttccagggcctgcagctggagcgtgaggcctgcctggcctcc
aactacgcgctggccaaggagaacctggccctgcggccccgcctggagatgggccgggct
gccctggccatcaaataccaggagcttcgtgaggtggccgagaactgcgcggacaagctg
cagcgactggaggaaagcatgcatcgctggagtccccactgcgcgctgggctggctgcag
gctgagctagaagaggcggagcaggaggcagaggagcagatggagcagctgctgctcggg
gagcaaagcctggaggccttcctgcctgccttccagcgtggccgcgccctggcccacctg
aggcggacgcaggcagagaagctgcaggagctgctgcggcgtcgggagcgttctgcccag
ccggcccccacctcggctgctgatccccccaaatccttcccggctgcagctgtcctgccc
actggggccgcccgggggccaccagcagtgccccggagcctgccccccttggactcccgc
ccagtgcccccactgaagggctcccccgggtgccccctcggcccggcccccctgctgagc
cctcggccctcgcagccagagcccccccaccggtag

DBGET integrated database retrieval system