KEGG   Homo sapiens (human): 1555
Entry
1555              CDS       T01001                                 

Symbol
CYP2B6, CPB6, CYP2B, CYP2B7, CYP2B7P, CYPIIB6, EFVM, IIB1, P450
Name
(RefSeq) cytochrome P450 family 2 subfamily B member 6
  KO
K17709  cytochrome P450 family 2 subfamily B6 [EC:1.14.14.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00590  Arachidonic acid metabolism
hsa00830  Retinol metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa01100  Metabolic pathways
hsa05207  Chemical carcinogenesis - receptor activation
hsa05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    1555 (CYP2B6)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    1555 (CYP2B6)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    1555 (CYP2B6)
   00982 Drug metabolism - cytochrome P450
    1555 (CYP2B6)
 09160 Human Diseases
  09161 Cancer: overview
   05207 Chemical carcinogenesis - receptor activation
    1555 (CYP2B6)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    1555 (CYP2B6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:hsa00199]
    1555 (CYP2B6)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.-  
     1555 (CYP2B6)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP2 family
   1555 (CYP2B6)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 1555
NCBI-ProteinID: NP_000758
OMIM: 123930
HGNC: 2615
Ensembl: ENSG00000197408
Vega: OTTHUMG00000182714
Pharos: P20813(Tbio)
UniProt: P20813
Structure
PDB: 

Position
19q13.2
AA seq 491 aa
MELSVLLFLALLTGLLLLLVQRHPNTHDRLPPGPRPLPLLGNLLQMDRRGLLKSFLRFRE
KYGDVFTVHLGPRPVVMLCGVEAIREALVDKAEAFSGRGKIAMVDPFFRGYGVIFANGNR
WKVLRRFSVTTMRDFGMGKRSVEERIQEEAQCLIEELRKSKGALMDPTFLFQSITANIIC
SIVFGKRFHYQDQEFLKMLNLFYQTFSLISSVFGQLFELFSGFLKYFPGAHRQVYKNLQE
INAYIGHSVEKHRETLDPSAPKDLIDTYLLHMEKEKSNAHSEFSHQNLNLNTLSLFFAGT
ETTSTTLRYGFLLMLKYPHVAERVYREIEQVIGPHRPPELHDRAKMPYTEAVIYEIQRFS
DLLPMGVPHIVTQHTSFRGYIIPKDTEVFLILSTALHDPHYFEKPDAFNPDHFLDANGAL
KKTEAFIPFSLGKRICLGEGIARAELFLFFTTILQNFSMASPVAPEDIDLTPQECGVGKI
PPTYQIRFLPR
NT seq 1476 nt   +upstreamnt  +downstreamnt
atggaactcagcgtcctcctcttccttgcactcctcacaggactcttgctactcctggtt
cagcgccaccctaacacccatgaccgcctcccaccagggccccgccctctgccccttttg
ggaaaccttctgcagatggatagaagaggcctactcaaatcctttctgaggttccgagag
aaatatggggacgtcttcacggtacacctgggaccgaggcccgtggtcatgctgtgtgga
gtagaggccatacgggaggcccttgtggacaaggctgaggccttctctggccggggaaaa
atcgccatggtcgacccattcttccggggatatggtgtgatctttgccaatggaaaccgc
tggaaggtgcttcggcgattctctgtgaccactatgagggacttcgggatgggaaagcgg
agtgtggaggagcggattcaggaggaggctcagtgtctgatagaggagcttcggaaatcc
aagggggccctcatggaccccaccttcctcttccagtccattaccgccaacatcatctgc
tccatcgtctttggaaaacgattccactaccaagatcaagagttcctgaagatgctgaac
ttgttctaccagactttttcactcatcagctctgtattcggccagctgtttgagctcttc
tctggcttcttgaaatactttcctggggcacacaggcaagtttacaaaaacctgcaggaa
atcaatgcttacattggccacagtgtggagaagcaccgtgaaaccctggaccccagcgcc
cccaaggacctcatcgacacctacctgctccacatggaaaaagagaaatccaacgcacac
agtgaattcagccaccagaacctcaacctcaacacgctctcgctcttctttgctggcact
gagaccaccagcaccactctccgctacggcttcctgctcatgctcaaataccctcatgtt
gcagagagagtctacagggagattgaacaggtgattggcccacatcgccctccagagctt
catgaccgagccaaaatgccatacacagaggcagtcatctatgagattcagagattttcc
gaccttctccccatgggtgtgccccacattgtcacccaacacaccagcttccgagggtac
atcatccccaaggacacagaagtatttctcatcctgagcactgctctccatgacccacac
tactttgaaaaaccagacgccttcaatcctgaccactttctggatgccaatggggcactg
aaaaagactgaagcttttatccccttctccttagggaagcggatttgtcttggtgaaggc
atcgcccgtgcggaattgttcctcttcttcaccaccatcctccagaacttctccatggcc
agccccgtggccccagaagacatcgatctgacaccccaggagtgtggtgtgggcaaaata
cccccaacataccagatccgcttcctgccccgctga

KEGG   Homo sapiens (human): 1558
Entry
1558              CDS       T01001                                 

Symbol
CYP2C8, CPC8, CYP2C8DM, CYPIIC8, MP-12/MP-20
Name
(RefSeq) cytochrome P450 family 2 subfamily C member 8
  KO
K17718  cytochrome P450 family 2 subfamily C8 [EC:1.14.14.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00830  Retinol metabolism
hsa00982  Drug metabolism - cytochrome P450
hsa01100  Metabolic pathways
hsa04726  Serotonergic synapse
hsa05204  Chemical carcinogenesis - DNA adducts
hsa05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    1558 (CYP2C8)
   00591 Linoleic acid metabolism
    1558 (CYP2C8)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    1558 (CYP2C8)
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    1558 (CYP2C8)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    1558 (CYP2C8)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis - DNA adducts
    1558 (CYP2C8)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    1558 (CYP2C8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:hsa00199]
    1558 (CYP2C8)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     1558 (CYP2C8)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP2 family
   1558 (CYP2C8)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 1558
NCBI-ProteinID: NP_000761
OMIM: 601129
HGNC: 2622
Ensembl: ENSG00000138115
Vega: OTTHUMG00000018804
Pharos: P10632(Tbio)
UniProt: P10632
Structure
PDB: 
2NNJ 2NNH 2VN0 1PQ2 2NNI

Position
10q23.33
AA seq 490 aa
MEPFVVLVLCLSFMLLFSLWRQSCRRRKLPPGPTPLPIIGNMLQIDVKDICKSFTNFSKV
YGPVFTVYFGMNPIVVFHGYEAVKEALIDNGEEFSGRGNSPISQRITKGLGIISSNGKRW
KEIRRFSLTTLRNFGMGKRSIEDRVQEEAHCLVEELRKTKASPCDPTFILGCAPCNVICS
VVFQKRFDYKDQNFLTLMKRFNENFRILNSPWIQVCNNFPLLIDCFPGTHNKVLKNVALT
RSYIREKVKEHQASLDVNNPRDFIDCFLIKMEQEKDNQKSEFNIENLVGTVADLFVAGTE
TTSTTLRYGLLLLLKHPEVTAKVQEEIDHVIGRHRSPCMQDRSHMPYTDAVVHEIQRYSD
LVPTGVPHAVTTDTKFRNYLIPKGTTIMALLTSVLHDDKEFPNPNIFDPGHFLDKNGNFK
KSDYFMPFSAGKRICAGEGLARMELFLFLTTILQNFNLKSVDDLKNLNTTAVTKGIVSLP
PSYQICFIPV
NT seq 1473 nt   +upstreamnt  +downstreamnt
atggaaccttttgtggtcctggtgctgtgtctctcttttatgcttctcttttcactctgg
agacagagctgtaggagaaggaagctccctcctggccccactcctcttcctattattgga
aatatgctacagatagatgttaaggacatctgcaaatctttcaccaatttctcaaaagtc
tatggtcctgtgttcaccgtgtattttggcatgaatcccatagtggtgtttcatggatat
gaggcagtgaaggaagccctgattgataatggagaggagttttctggaagaggcaattcc
ccaatatctcaaagaattactaaaggacttggaatcatttccagcaatggaaagagatgg
aaggagatccggcgtttctccctcacaaccttgcggaattttgggatggggaagaggagc
attgaggaccgtgttcaagaggaagctcactgccttgtggaggagttgagaaaaaccaag
gcttcaccctgtgatcccactttcatcctgggctgtgctccctgcaatgtgatctgctcc
gttgttttccagaaacgatttgattataaagatcagaattttctcaccctgatgaaaaga
ttcaatgaaaacttcaggattctgaactccccatggatccaggtctgcaataatttccct
ctactcattgattgtttcccaggaactcacaacaaagtgcttaaaaatgttgctcttaca
cgaagttacattagggagaaagtaaaagaacaccaagcatcactggatgttaacaatcct
cgggactttatcgattgcttcctgatcaaaatggagcaggaaaaggacaaccaaaagtca
gaattcaatattgaaaacttggttggcactgtagctgatctatttgttgctggaacagag
acaacaagcaccactctgagatatggactcctgctcctgctgaagcacccagaggtcaca
gctaaagtccaggaagagattgatcatgtaattggcagacacaggagcccctgcatgcag
gataggagccacatgccttacactgatgctgtagtgcacgagatccagagatacagtgac
cttgtccccaccggtgtgccccatgcagtgaccactgatactaagttcagaaactacctc
atccccaagggcacaaccataatggcattactgacttccgtgctacatgatgacaaagaa
tttcctaatccaaatatctttgaccctggccactttctagataagaatggcaactttaag
aaaagtgactacttcatgcctttctcagcaggaaaacgaatttgtgcaggagaaggactt
gcccgcatggagctatttttatttctaaccacaattttacagaactttaacctgaaatct
gttgatgatttaaagaacctcaatactactgcagttaccaaagggattgtttctctgcca
ccctcataccagatctgcttcatccctgtctga

KEGG   Homo sapiens (human): 1559
Entry
1559              CDS       T01001                                 

Symbol
CYP2C9, CPC9, CYP2C, CYP2C10, CYPIIC9, P450IIC9
Name
(RefSeq) cytochrome P450 family 2 subfamily C member 9
  KO
K17719  cytochrome P450 family 2 subfamily C9 [EC:1.14.14.51 1.14.14.52 1.14.14.53 1.14.14.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00830  Retinol metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa01100  Metabolic pathways
hsa04726  Serotonergic synapse
hsa05204  Chemical carcinogenesis - DNA adducts
hsa05417  Lipid and atherosclerosis
Disease
H01205  Coumarin resistance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    1559 (CYP2C9)
   00591 Linoleic acid metabolism
    1559 (CYP2C9)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    1559 (CYP2C9)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    1559 (CYP2C9)
   00982 Drug metabolism - cytochrome P450
    1559 (CYP2C9)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    1559 (CYP2C9)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis - DNA adducts
    1559 (CYP2C9)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    1559 (CYP2C9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:hsa00199]
    1559 (CYP2C9)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.51  (S)-limonene 6-monooxygenase
     1559 (CYP2C9)
    1.14.14.52  (S)-limonene 7-monooxygenase
     1559 (CYP2C9)
    1.14.14.53  (R)-limonene 6-monooxygenase
     1559 (CYP2C9)
    1.14.14.-  
     1559 (CYP2C9)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP2 family
   1559 (CYP2C9)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 1559
NCBI-ProteinID: NP_000762
OMIM: 601130
HGNC: 2623
Ensembl: ENSG00000138109
Vega: OTTHUMG00000018805
Pharos: P11712(Tchem)
UniProt: P11712 S5RV20
Structure
PDB: 

Position
10q23.33
AA seq 490 aa
MDSLVVLVLCLSCLLLLSLWRQSSGRGKLPPGPTPLPVIGNILQIGIKDISKSLTNLSKV
YGPVFTLYFGLKPIVVLHGYEAVKEALIDLGEEFSGRGIFPLAERANRGFGIVFSNGKKW
KEIRRFSLMTLRNFGMGKRSIEDRVQEEARCLVEELRKTKASPCDPTFILGCAPCNVICS
IIFHKRFDYKDQQFLNLMEKLNENIKILSSPWIQICNNFSPIIDYFPGTHNKLLKNVAFM
KSYILEKVKEHQESMDMNNPQDFIDCFLMKMEKEKHNQPSEFTIESLENTAVDLFGAGTE
TTSTTLRYALLLLLKHPEVTAKVQEEIERVIGRNRSPCMQDRSHMPYTDAVVHEVQRYID
LLPTSLPHAVTCDIKFRNYLIPKGTTILISLTSVLHDNKEFPNPEMFDPHHFLDEGGNFK
KSKYFMPFSAGKRICVGEALAGMELFLFLTSILQNFNLKSLVDPKNLDTTPVVNGFASVP
PFYQLCFIPV
NT seq 1473 nt   +upstreamnt  +downstreamnt
atggattctcttgtggtccttgtgctctgtctctcatgtttgcttctcctttcactctgg
agacagagctctgggagaggaaaactccctcctggccccactcctctcccagtgattgga
aatatcctacagataggtattaaggacatcagcaaatccttaaccaatctctcaaaggtc
tatggccctgtgttcactctgtattttggcctgaaacccatagtggtgctgcatggatat
gaagcagtgaaggaagccctgattgatcttggagaggagttttctggaagaggcattttc
ccactggctgaaagagctaacagaggatttggaattgttttcagcaatggaaagaaatgg
aaggagatccggcgtttctccctcatgacgctgcggaattttgggatggggaagaggagc
attgaggaccgtgttcaagaggaagcccgctgccttgtggaggagttgagaaaaaccaag
gcctcaccctgtgatcccactttcatcctgggctgtgctccctgcaatgtgatctgctcc
attattttccataaacgttttgattataaagatcagcaatttcttaacttaatggaaaag
ttgaatgaaaacatcaagattttgagcagcccctggatccagatctgcaataatttttct
cctatcattgattacttcccgggaactcacaacaaattacttaaaaacgttgcttttatg
aaaagttatattttggaaaaagtaaaagaacaccaagaatcaatggacatgaacaaccct
caggactttattgattgcttcctgatgaaaatggagaaggaaaagcacaaccaaccatct
gaatttactattgaaagcttggaaaacactgcagttgacttgtttggagctgggacagag
acgacaagcacaaccctgagatatgctctccttctcctgctgaagcacccagaggtcaca
gctaaagtccaggaagagattgaacgtgtgattggcagaaaccggagcccctgcatgcaa
gacaggagccacatgccctacacagatgctgtggtgcacgaggtccagagatacattgac
cttctccccaccagcctgccccatgcagtgacctgtgacattaaattcagaaactatctc
attcccaagggcacaaccatattaatttccctgacttctgtgctacatgacaacaaagaa
tttcccaacccagagatgtttgaccctcatcactttctggatgaaggtggcaattttaag
aaaagtaaatacttcatgcctttctcagcaggaaaacggatttgtgtgggagaagccctg
gccggcatggagctgtttttattcctgacctccattttacagaactttaacctgaaatct
ctggttgacccaaagaaccttgacaccactccagttgtcaatggatttgcctctgtgccg
cccttctaccagctgtgcttcattcctgtctga

KEGG   Homo sapiens (human): 1573
Entry
1573              CDS       T01001                                 

Symbol
CYP2J2, CPJ2, CYPIIJ2
Name
(RefSeq) cytochrome P450 family 2 subfamily J member 2
  KO
K07418  cytochrome P450 family 2 subfamily J [EC:1.14.14.1 1.14.14.73 1.14.14.74 1.14.14.75]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa01100  Metabolic pathways
hsa04726  Serotonergic synapse
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04913  Ovarian steroidogenesis
hsa05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    1573 (CYP2J2)
   00591 Linoleic acid metabolism
    1573 (CYP2J2)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    1573 (CYP2J2)
  09156 Nervous system
   04726 Serotonergic synapse
    1573 (CYP2J2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    1573 (CYP2J2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    1573 (CYP2J2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:hsa00199]
    1573 (CYP2J2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     1573 (CYP2J2)
    1.14.14.73  albendazole monooxygenase (sulfoxide-forming)
     1573 (CYP2J2)
    1.14.14.74  albendazole monooxygenase (hydroxylating)
     1573 (CYP2J2)
    1.14.14.75  fenbendazole monooxygenase (4'-hydroxylating)
     1573 (CYP2J2)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP2 family
   1573 (CYP2J2)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 1573
NCBI-ProteinID: NP_000766
OMIM: 601258
HGNC: 2634
Ensembl: ENSG00000134716
Vega: OTTHUMG00000008991
Pharos: P51589(Tchem)
UniProt: P51589
Position
1p32.1
AA seq 502 aa
MLAAMGSLAAALWAVVHPRTLLLGTVAFLLAADFLKRRRPKNYPPGPWRLPFLGNFFLVD
FEQSHLEVQLFVKKYGNLFSLELGDISAVLITGLPLIKEALIHMDQNFGNRPVTPMREHI
FKKNGLIMSSGQAWKEQRRFTLTALRNFGLGKKSLEERIQEEAQHLTEAIKEENGQPFDP
HFKINNAVSNIICSITFGERFEYQDSWFQQLLKLLDEVTYLEASKTCQLYNVFPWIMKFL
PGPHQTLFSNWKKLKLFVSHMIDKHRKDWNPAETRDFIDAYLKEMSKHTGNPTSSFHEEN
LICSTLDLFFAGTETTSTTLRWALLYMALYPEIQEKVQAEIDRVIGQGQQPSTAARESMP
YTNAVIHEVQRMGNIIPLNVPREVTVDTTLAGYHLPKGTMILTNLTALHRDPTEWATPDT
FNPDHFLENGQFKKREAFMPFSIGKRACLGEQLARTELFIFFTSLMQKFTFRPPNNEKLS
LKFRMGITISPVSHRLCAVPQV
NT seq 1509 nt   +upstreamnt  +downstreamnt
atgctcgcggcgatgggctctctggcggctgccctctgggcagtggtccatcctcggact
ctcctactgggcactgtcgcctttctgctcgctgctgactttctcaaaagacggcgccca
aagaactacccgccggggccctggcgcctgcccttccttggcaacttcttccttgtggac
ttcgagcagtcgcacctggaggttcagctgtttgtgaagaaatatgggaacctttttagc
ttggagcttggtgacatatctgcagttcttattactggcttgcccttaatcaaagaagcc
cttatccacatggaccaaaactttgggaaccgccccgtgacccctatgcgagaacatatc
tttaagaaaaatggattgattatgtcaagtggccaggcatggaaggagcaaagaaggttc
actctgacagcactaaggaactttggtttaggaaagaagagcttagaggaacgcattcag
gaggaggcccaacacctcactgaagcaataaaagaggagaacggacagccttttgaccct
catttcaagatcaacaatgcagtttccaatatcatttgctccatcaccttcggagaacgc
tttgagtaccaggatagttggtttcagcagctgctgaagttactagatgaagtcacatac
ttggaggcttcaaagacatgccagctctacaatgtctttccatggataatgaaattcctg
cctggaccccaccaaactctcttcagcaactggaaaaaactgaaattgtttgtttctcat
atgattgacaaacacagaaaggattggaatcctgcagaaacaagagactttattgatgct
taccttaaagaaatgtcaaagcacacaggcaatcctacttcaagtttccatgaagaaaac
ctcatctgcagcaccctggacctcttctttgccggaaccgagacaacttccacaactctg
cgatgggctctgctttatatggccctctacccagaaatccaagaaaaagtacaagctgag
attgacagagtgattggccaggggcagcagccgagcacagccgcccgggagtccatgccc
tacaccaatgctgtcatccatgaggtgcagagaatgggcaacatcatccccctgaacgtt
cccagggaagtgacagttgataccactttggctgggtaccacctgcccaagggtaccatg
atcctgaccaatttgacggcgctgcacagggaccccacagagtgggccacccctgacaca
ttcaatccggaccattttctggagaatggacagtttaagaaaagggaagcctttatgcct
ttctcaataggaaagcgggcatgcctcggagaacagttggccaggactgagctgtttatt
ttcttcacttcccttatgcaaaaatttaccttcaggcccccaaacaatgagaagctgagc
ctgaagtttagaatgggtatcaccatttccccagtcagtcaccgcctctgcgctgttcct
caggtgtaa

DBGET integrated database retrieval system