KEGG   Homo sapiens (human): 156Help
Entry
156               CDS       T01001                                 

Gene name
GRK2, ADRBK1, BARK1, BETA-ARK1
Definition
(RefSeq) G protein-coupled receptor kinase 2
  KO
K00910  beta-adrenergic-receptor kinase [EC:2.7.11.15]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04062  Chemokine signaling pathway
hsa04144  Endocytosis
hsa04340  Hedgehog signaling pathway
hsa04724  Glutamatergic synapse
hsa04740  Olfactory transduction
hsa05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    156 (GRK2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    156 (GRK2)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    156 (GRK2)
  09156 Nervous system
   04724 Glutamatergic synapse
    156 (GRK2)
  09157 Sensory system
   04740 Olfactory transduction
    156 (GRK2)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    156 (GRK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    156 (GRK2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    156 (GRK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.15  beta-adrenergic-receptor kinase
     156 (GRK2)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   156 (GRK2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   156 (GRK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr RGS PH Kinase-like Pkinase_fungal HTH_WhiA
Motif
Other DBs
NCBI-GeneID: 156
NCBI-ProteinID: NP_001610
OMIM: 109635
HGNC: 289
Ensembl: ENSG00000173020
Vega: OTTHUMG00000167104
Pharos: P25098(Tbio)
UniProt: P25098 A0A0S2Z392
Structure
PDB: 

Position
11q13.2
AA seq 689 aa AA seqDB search
MADLEAVLADVSYLMAMEKSKATPAARASKKILLPEPSIRSVMQKYLEDRGEVTFEKIFS
QKLGYLLFRDFCLNHLEEARPLVEFYEEIKKYEKLETEEERVARSREIFDSYIMKELLAC
SHPFSKSATEHVQGHLGKKQVPPDLFQPYIEEICQNLRGDVFQKFIESDKFTRFCQWKNV
ELNIHLTMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRIKMKQGETLALNER
IMLSLVSTGDCPFIVCMSYAFHTPDKLSFILDLMNGGDLHYHLSQHGVFSEADMRFYAAE
IILGLEHMHNRFVVYRDLKPANILLDEHGHVRISDLGLACDFSKKKPHASVGTHGYMAPE
VLQKGVAYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEIDRMTLTMAVELPDSFSPE
LRSLLEGLLQRDVNRRLGCLGRGAQEVKESPFFRSLDWQMVFLQKYPPPLIPPRGEVNAA
DAFDIGSFDEEDTKGIKLLDSDQELYRNFPLTISERWQQEVAETVFDTINAETDRLEARK
KAKNKQLGHEEDYALGKDCIMHGYMSKMGNPFLTQWQRRYFYLFPNRLEWRGEGEAPQSL
LTMEEIQSVEETQIKERKCLLLKIRGGKQFILQCDSDPELVQWKKELRDAYREAQQLVQR
VPKMKNKPRSPVVELSKVPLVQRGSANGL
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atggcggacctggaggcggtgctggccgacgtgagctacctgatggccatggagaagagc
aaggccacgccggccgcgcgcgccagcaagaagatcctgctgcccgagcccagcatccgc
agtgtcatgcagaagtacctggaggaccggggcgaggtgacctttgagaagatcttttcc
cagaagctggggtacctgctcttccgagacttctgcctgaaccacctggaggaggccagg
cccttggtggaattctatgaggagatcaagaagtacgagaagctggagacggaggaggag
cgtgtggcccgcagccgggagatcttcgactcatacatcatgaaggagctgctggcctgc
tcgcatcccttctcgaagagtgccactgagcatgtccaaggccacctggggaagaagcag
gtgcctccggatctcttccagccatacatcgaagagatttgtcaaaacctccgaggggac
gtgttccagaaattcattgagagcgataagttcacacggttttgccagtggaagaatgtg
gagctcaacatccacctgaccatgaatgacttcagcgtgcatcgcatcattgggcgcggg
ggctttggcgaggtctatgggtgccggaaggctgacacaggcaagatgtacgccatgaag
tgcctggacaaaaagcgcatcaagatgaagcagggggagaccctggccctgaacgagcgc
atcatgctctcgctcgtcagcactggggactgcccattcattgtctgcatgtcatacgcg
ttccacacgccagacaagctcagcttcatcctggacctcatgaacggtggggacctgcac
taccacctctcccagcacggggtcttctcagaggctgacatgcgcttctatgcggccgag
atcatcctgggcctggagcacatgcacaaccgcttcgtggtctaccgggacctgaagcca
gccaacatccttctggacgagcatggccacgtgcggatctcggacctgggcctggcctgt
gacttctccaagaagaagccccatgccagcgtgggcacccacgggtacatggctccggag
gtcctgcagaagggcgtggcctacgacagcagtgccgactggttctctctggggtgcatg
ctcttcaagttgctgcgggggcacagccccttccggcagcacaagaccaaagacaagcat
gagatcgaccgcatgacgctgacgatggccgtggagctgcccgactccttctcccctgaa
ctacgctccctgctggaggggttgctgcagagggatgtcaaccggagattgggctgcctg
ggccgaggggctcaggaggtgaaagagagcccctttttccgctccctggactggcagatg
gtcttcttgcagaagtaccctcccccgctgatccccccacgaggggaggtgaacgcggcc
gacgccttcgacattggctccttcgatgaggaggacacaaaaggaatcaagttactggac
agtgatcaggagctctaccgcaacttccccctcaccatctcggagcggtggcagcaggag
gtggcagagactgtcttcgacaccatcaacgctgagacagaccggctggaggctcgcaag
aaagccaagaacaagcagctgggccatgaggaagactacgccctgggcaaggactgcatc
atgcatggctacatgtccaagatgggcaaccccttcctgacccagtggcagcggcggtac
ttctacctgttccccaaccgcctcgagtggcggggcgagggcgaggccccgcagagcctg
ctgaccatggaggagatccagtcggtggaggagacgcagatcaaggagcgcaagtgcctg
ctcctcaagatccgcggtgggaaacagttcattttgcagtgcgatagcgaccctgagctg
gtgcagtggaagaaggagctgcgcgacgcctaccgcgaggcccagcagctggtgcagcgg
gtgcccaagatgaagaacaagccgcgctcgcccgtggtggagctgagcaaggtgccgctg
gtccagcgcggcagtgccaacggcctctga

DBGET integrated database retrieval system