KEGG   Homo sapiens (human): 157Help
Entry
157               CDS       T01001                                 

Gene name
GRK3, ADRBK2, BARK2
Definition
(RefSeq) G protein-coupled receptor kinase 3
  KO
K00910  beta-adrenergic-receptor kinase [EC:2.7.11.15]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04062  Chemokine signaling pathway
hsa04144  Endocytosis
hsa04340  Hedgehog signaling pathway
hsa04724  Glutamatergic synapse
hsa04740  Olfactory transduction
hsa05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    157 (GRK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    157 (GRK3)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    157 (GRK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    157 (GRK3)
  09157 Sensory system
   04740 Olfactory transduction
    157 (GRK3)
 09160 Human Diseases
  09164 Substance dependence
   05032 Morphine addiction
    157 (GRK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    157 (GRK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    157 (GRK3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.15  beta-adrenergic-receptor kinase
     157 (GRK3)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   157 (GRK3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   157 (GRK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr RGS PH HTH_WhiA
Motif
Other DBs
NCBI-GeneID: 157
NCBI-ProteinID: NP_005151
OMIM: 109636
HGNC: 290
Ensembl: ENSG00000100077
Vega: OTTHUMG00000150280
Pharos: P35626(Tbio)
UniProt: P35626 Q8N433 A0A024R1D8
Position
22q12.1
AA seq 688 aa AA seqDB search
MADLEAVLADVSYLMAMEKSKATPAARASKRIVLPEPSIRSVMQKYLAERNEITFDKIFN
QKIGFLLFKDFCLNEINEAVPQVKFYEEIKEYEKLDNEEDRLCRSRQIYDAYIMKELLSC
SHPFSKQAVEHVQSHLSKKQVTSTLFQPYIEEICESLRGDIFQKFMESDKFTRFCQWKNV
ELNIHLTMNEFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRIKMKQGETLALNER
IMLSLVSTGDCPFIVCMTYAFHTPDKLCFILDLMNGGDLHYHLSQHGVFSEKEMRFYATE
IILGLEHMHNRFVVYRDLKPANILLDEHGHARISDLGLACDFSKKKPHASVGTHGYMAPE
VLQKGTAYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEIDRMTLTVNVELPDTFSPE
LKSLLEGLLQRDVSKRLGCHGGGSQEVKEHSFFKGVDWQHVYLQKYPPPLIPPRGEVNAA
DAFDIGSFDEEDTKGIKLLDCDQELYKNFPLVISERWQQEVTETVYEAVNADTDKIEARK
RAKNKQLGHEEDYALGKDCIMHGYMLKLGNPFLTQWQRRYFYLFPNRLEWRGEGESRQNL
LTMEQILSVEETQIKDKKCILFRIKGGKQFVLQCESDPEFVQWKKELNETFKEAQRLLRR
APKFLNKPRSGTVELPKPSLCHRNSNGL
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atggcggacctggaggctgtgctggccgatgtcagttacctgatggccatggagaagagc
aaggcgaccccggccgcccgcgccagcaagaggatcgtcctgccggagcccagtatccgg
agtgtgatgcagaagtaccttgcagagagaaatgaaataacctttgacaagattttcaat
cagaaaattggtttcttgctatttaaagatttttgtttgaatgaaattaatgaagctgta
cctcaggtgaagttttatgaagagataaaggaatatgaaaaacttgataatgaggaagac
cgcctttgcagaagtcgacaaatttatgatgcctacatcatgaaggaacttctttcctgt
tcacatcctttctcaaagcaagctgtagaacacgtacaaagtcatttatccaagaaacaa
gtgacatcaactctttttcagccatacatagaagaaatttgtgaaagccttcgaggtgac
atttttcaaaaatttatggaaagtgacaagttcactagattttgtcagtggaaaaacgtt
gaattaaatatccatttgaccatgaatgagttcagtgtgcataggattattggacgagga
ggattcggggaagtttatggttgcaggaaagcagacactggaaaaatgtatgcaatgaaa
tgcttagataagaagaggatcaaaatgaaacaaggagaaacattagccttaaatgaaaga
atcatgttgtctcttgtcagcacaggagactgtcctttcattgtatgtatgacctatgcc
ttccataccccagataaactctgcttcatcctggatctgatgaacgggggcgatttgcac
taccacctttcacaacacggtgtgttctctgagaaggagatgcggttttatgccactgaa
atcattctgggtctggaacacatgcacaatcggtttgttgtctacagagatttgaagcca
gcaaatattctcttggatgaacatggacacgcaagaatatcagatcttggtcttgcctgc
gatttttccaaaaagaagcctcatgcgagtgttggcacccatgggtacatggctcccgag
gtgctgcagaaggggacggcctatgacagcagtgccgactggttctccctgggctgcatg
cttttcaaacttctgagaggtcacagccctttcagacaacataaaaccaaagacaagcat
gaaattgaccgaatgacactcaccgtgaatgtggaacttccagacaccttctctcctgaa
ctgaagtcccttttggagggcttgcttcagcgagacgttagcaagcggctgggctgtcac
ggaggcggctcacaggaagtaaaagagcacagctttttcaaaggtgttgactggcagcat
gtctacttacaaaagtacccaccacccttgattcctccccggggagaagtcaatgctgct
gatgcctttgatattggctcatttgatgaagaggataccaaagggattaagctacttgat
tgcgaccaagaactctacaagaacttccctttggtcatctctgaacgctggcagcaagaa
gtaacggaaacagtttatgaagcagtaaatgcagacacagataaaatcgaggccaggaag
agagctaaaaataagcaacttggccacgaagaagattacgctctggggaaggactgtatt
atgcacgggtacatgctgaaactgggaaacccatttctgactcagtggcagcgtcgctat
ttttacctctttccaaatagacttgaatggagaggagagggagagtcccggcaaaattta
ctgacaatggaacagattctctctgtggaagaaactcaaattaaagacaaaaaatgcatt
ttgttcagaataaaaggagggaaacaatttgtcttgcaatgtgagagtgatccagagttt
gtgcagtggaagaaagagttgaacgaaaccttcaaggaggcccagcggctattgcgtcgt
gccccgaagttcctcaacaaacctcggtcaggtactgtggagctcccaaagccatccctc
tgtcacagaaacagcaacggcctctag

DBGET integrated database retrieval system