KEGG   Homo sapiens (human): 1573Help
Entry
1573              CDS       T01001                                 

Gene name
CYP2J2, CPJ2, CYPIIJ2
Definition
(RefSeq) cytochrome P450 family 2 subfamily J member 2
  KO
K07418  cytochrome P450 family 2 subfamily J [EC:1.14.14.1 1.14.14.73 1.14.14.74 1.14.14.75]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa01100  Metabolic pathways
hsa04726  Serotonergic synapse
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04913  Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    1573 (CYP2J2)
   00591 Linoleic acid metabolism
    1573 (CYP2J2)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    1573 (CYP2J2)
  09156 Nervous system
   04726 Serotonergic synapse
    1573 (CYP2J2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    1573 (CYP2J2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:hsa00199]
    1573 (CYP2J2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     1573 (CYP2J2)
    1.14.14.73  albendazole monooxygenase (sulfoxide-forming)
     1573 (CYP2J2)
    1.14.14.74  albendazole monooxygenase (hydroxylating)
     1573 (CYP2J2)
    1.14.14.75  fenbendazole monooxygenase (4'-hydroxylating)
     1573 (CYP2J2)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP2 family
   1573 (CYP2J2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 1573
NCBI-ProteinID: NP_000766
OMIM: 601258
HGNC: 2634
Ensembl: ENSG00000134716
Vega: OTTHUMG00000008991
Pharos: P51589(Tchem)
UniProt: P51589
Position
1p32.1
AA seq 502 aa AA seqDB search
MLAAMGSLAAALWAVVHPRTLLLGTVAFLLAADFLKRRRPKNYPPGPWRLPFLGNFFLVD
FEQSHLEVQLFVKKYGNLFSLELGDISAVLITGLPLIKEALIHMDQNFGNRPVTPMREHI
FKKNGLIMSSGQAWKEQRRFTLTALRNFGLGKKSLEERIQEEAQHLTEAIKEENGQPFDP
HFKINNAVSNIICSITFGERFEYQDSWFQQLLKLLDEVTYLEASKTCQLYNVFPWIMKFL
PGPHQTLFSNWKKLKLFVSHMIDKHRKDWNPAETRDFIDAYLKEMSKHTGNPTSSFHEEN
LICSTLDLFFAGTETTSTTLRWALLYMALYPEIQEKVQAEIDRVIGQGQQPSTAARESMP
YTNAVIHEVQRMGNIIPLNVPREVTVDTTLAGYHLPKGTMILTNLTALHRDPTEWATPDT
FNPDHFLENGQFKKREAFMPFSIGKRACLGEQLARTELFIFFTSLMQKFTFRPPNNEKLS
LKFRMGITISPVSHRLCAVPQV
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcggcgatgggctctctggcggctgccctctgggcagtggtccatcctcggact
ctcctactgggcactgtcgcctttctgctcgctgctgactttctcaaaagacggcgccca
aagaactacccgccggggccctggcgcctgcccttccttggcaacttcttccttgtggac
ttcgagcagtcgcacctggaggttcagctgtttgtgaagaaatatgggaacctttttagc
ttggagcttggtgacatatctgcagttcttattactggcttgcccttaatcaaagaagcc
cttatccacatggaccaaaactttgggaaccgccccgtgacccctatgcgagaacatatc
tttaagaaaaatggattgattatgtcaagtggccaggcatggaaggagcaaagaaggttc
actctgacagcactaaggaactttggtttaggaaagaagagcttagaggaacgcattcag
gaggaggcccaacacctcactgaagcaataaaagaggagaacggacagccttttgaccct
catttcaagatcaacaatgcagtttccaatatcatttgctccatcaccttcggagaacgc
tttgagtaccaggatagttggtttcagcagctgctgaagttactagatgaagtcacatac
ttggaggcttcaaagacatgccagctctacaatgtctttccatggataatgaaattcctg
cctggaccccaccaaactctcttcagcaactggaaaaaactgaaattgtttgtttctcat
atgattgacaaacacagaaaggattggaatcctgcagaaacaagagactttattgatgct
taccttaaagaaatgtcaaagcacacaggcaatcctacttcaagtttccatgaagaaaac
ctcatctgcagcaccctggacctcttctttgccggaaccgagacaacttccacaactctg
cgatgggctctgctttatatggccctctacccagaaatccaagaaaaagtacaagctgag
attgacagagtgattggccaggggcagcagccgagcacagccgcccgggagtccatgccc
tacaccaatgctgtcatccatgaggtgcagagaatgggcaacatcatccccctgaacgtt
cccagggaagtgacagttgataccactttggctgggtaccacctgcccaagggtaccatg
atcctgaccaatttgacggcgctgcacagggaccccacagagtgggccacccctgacaca
ttcaatccggaccattttctggagaatggacagtttaagaaaagggaagcctttatgcct
ttctcaataggaaagcgggcatgcctcggagaacagttggccaggactgagctgtttatt
ttcttcacttcccttatgcaaaaatttaccttcaggcccccaaacaatgagaagctgagc
ctgaagtttagaatgggtatcaccatttccccagtcagtcaccgcctctgcgctgttcct
caggtgtaa

DBGET integrated database retrieval system