KEGG   Homo sapiens (human): 157310Help
Entry
157310            CDS       T01001                                 

Gene name
PEBP4, CORK-1, CORK1, GWTM1933, HEL-S-300, PEBP-4, PRO4408, hPEBP4
Definition
(RefSeq) phosphatidylethanolamine binding protein 4
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: PBP
Motif
Other DBs
NCBI-GeneID: 157310
NCBI-ProteinID: NP_659399
OMIM: 612473
HGNC: 28319
Ensembl: ENSG00000134020
Vega: OTTHUMG00000163749
Pharos: Q96S96(Tbio)
UniProt: Q96S96
Position
8p21.3
AA seq 227 aa AA seqDB search
MGWTMRLVTAALLLGLMMVVTGDEDENSPCAHEALLDEDTLFCQGLEVFYPELGNIGCKV
VPDCNNYRQKITSWMEPIVKFPGAVDGATYILVMVDPDAPSRAEPRQRFWRHWLVTDIKG
ADLKKGKIQGQELSAYQAPSPPAHSGFHRYQFFVYLQEGKVISLLPKENKTRGSWKMDRF
LNRFHLGEPEASTQFMTQNYQDSPTLQAPRERASEPKHKNQAEIAAC
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgggttggacaatgaggctggtcacagcagcactgttactgggtctcatgatggtggtc
actggagacgaggatgagaacagcccgtgtgcccatgaggccctcttggacgaggacacc
ctcttttgccagggccttgaagttttctacccagagttggggaacattggctgcaaggtt
gttcctgattgtaacaactacagacagaagatcacctcctggatggagccgatagtcaag
ttcccgggggccgtggacggcgcaacctatatcctggtgatggtggatccagatgcccct
agcagagcagaacccagacagagattctggagacattggctggtaacagatatcaagggc
gccgacctgaagaaagggaagattcagggccaggagttatcagcctaccaggctccctcc
ccaccggcacacagtggcttccatcgctaccagttctttgtctatcttcaggaaggaaaa
gtcatctctctccttcccaaggaaaacaaaactcgaggctcttggaaaatggacagattt
ctgaaccgtttccacctgggcgaacctgaagcaagcacccagttcatgacccagaactac
caggactcaccaaccctccaggctcccagagaaagggccagcgagcccaagcacaaaaac
caggcggagatagctgcctgctag

DBGET integrated database retrieval system