KEGG   Homo sapiens (human): 1576Help
Entry
1576              CDS       T01001                                 

Gene name
CYP3A4, CP33, CP34, CYP3A, CYP3A3, CYPIIIA3, CYPIIIA4, HLP, NF-25, P450C3, P450PCN1
Definition
(RefSeq) cytochrome P450 family 3 subfamily A member 4
  KO
K17689  cytochrome P450 family 3 subfamily A polypeptide 4 [EC:1.14.13.32 1.14.14.55 1.14.14.56 1.14.14.57 1.14.13.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00140  Steroid hormone biosynthesis
hsa00591  Linoleic acid metabolism
hsa00830  Retinol metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa04976  Bile secretion
hsa05204  Chemical carcinogenesis
Drug target
Cobicistat: D09881
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    1576 (CYP3A4)
   00591 Linoleic acid metabolism
    1576 (CYP3A4)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    1576 (CYP3A4)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    1576 (CYP3A4)
   00982 Drug metabolism - cytochrome P450
    1576 (CYP3A4)
   00983 Drug metabolism - other enzymes
    1576 (CYP3A4)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    1576 (CYP3A4)
 09160 Human Diseases
  09161 Cancers
   05204 Chemical carcinogenesis
    1576 (CYP3A4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:hsa00199]
    1576 (CYP3A4)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.32  albendazole monooxygenase
     1576 (CYP3A4)
    1.14.13.-  
     1576 (CYP3A4)
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.55  quinine 3-monooxygenase
     1576 (CYP3A4)
    1.14.14.56  1,8-cineole 2-exo-monooxygenase
     1576 (CYP3A4)
    1.14.14.57  taurochenodeoxycholate 6alpha-hydroxylase
     1576 (CYP3A4)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP3 family
   1576 (CYP3A4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450 Coa1
Motif
Other DBs
NCBI-GeneID: 1576
NCBI-ProteinID: NP_059488
OMIM: 124010
HGNC: 2637
Ensembl: ENSG00000160868
Vega: OTTHUMG00000156651
Pharos: P08684(Tclin)
UniProt: P08684 Q6GRK0
Structure
PDB: 

Position
7q22.1
AA seq 503 aa AA seqDB search
MALIPDLAMETWLLLAVSLVLLYLYGTHSHGLFKKLGIPGPTPLPFLGNILSYHKGFCMF
DMECHKKYGKVWGFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPFGPVGFMKSAISI
AEDEEWKRLRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKDVFGAYS
MDVITSTSFGVNIDSLNNPQDPFVENTKKLLRFDFLDPFFLSITVFPFLIPILEVLNICV
FPREVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSI
IFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTVLQMEYLDMVV
NETLRLFPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFS
KKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLG
GLLQPEKPVVLKVESRDGTVSGA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggctctcatcccagacttggccatggaaacctggcttctcctggctgtcagcctggtg
ctcctctatctatatggaacccattcacatggactttttaagaagcttggaattccaggg
cccacacctctgccttttttgggaaatattttgtcctaccataagggcttttgtatgttt
gacatggaatgtcataaaaagtatggaaaagtgtggggcttttatgatggtcaacagcct
gtgctggctatcacagatcctgacatgatcaaaacagtgctagtgaaagaatgttattct
gtcttcacaaaccggaggccttttggtccagtgggatttatgaaaagtgccatctctata
gctgaggatgaagaatggaagagattacgatcattgctgtctccaaccttcaccagtgga
aaactcaaggagatggtccctatcattgcccagtatggagatgtgttggtgagaaatctg
aggcgggaagcagagacaggcaagcctgtcaccttgaaagacgtctttggggcctacagc
atggatgtgatcactagcacatcatttggagtgaacatcgactctctcaacaatccacaa
gacccctttgtggaaaacaccaagaagcttttaagatttgattttttggatccattcttt
ctctcaataacagtctttccattcctcatcccaattcttgaagtattaaatatctgtgtg
tttccaagagaagttacaaattttttaagaaaatctgtaaaaaggatgaaagaaagtcgc
ctcgaagatacacaaaagcaccgagtggatttccttcagctgatgattgactctcagaat
tcaaaagaaactgagtcccacaaagctctgtccgatctggagctcgtggcccaatcaatt
atctttatttttgctggctatgaaaccacgagcagtgttctctccttcattatgtatgaa
ctggccactcaccctgatgtccagcagaaactgcaggaggaaattgatgcagttttaccc
aataaggcaccacccacctatgatactgtgctacagatggagtatcttgacatggtggtg
aatgaaacgctcagattattcccaattgctatgagacttgagagggtctgcaaaaaagat
gttgagatcaatgggatgttcattcccaaaggggtggtggtgatgattccaagctatgct
cttcaccgtgacccaaagtactggacagagcctgagaagttcctccctgaaagattcagc
aagaagaacaaggacaacatagatccttacatatacacaccctttggaagtggacccaga
aactgcattggcatgaggtttgctctcatgaacatgaaacttgctctaatcagagtcctt
cagaacttctccttcaaaccttgtaaagaaacacagatccccctgaaattaagcttagga
ggacttcttcaaccagaaaaacccgttgttctaaaggttgagtcaagggatggcaccgta
agtggagcctga

DBGET integrated database retrieval system