KEGG   Homo sapiens (human): 157657
Entry
157657            CDS       T01001                                 
Symbol
CFAP418, BBS21, C8orf37, CORD16, FAP418, MOT25, RP64, smalltalk
Name
(RefSeq) cilia and flagella associated protein 418
  KO
K25226  protein C8orf37
Organism
hsa  Homo sapiens (human)
Disease
H00418  Bardet-Biedl syndrome
H00481  Cone-rod dystrophy and cone dystrophy
H00527  Retinitis pigmentosa
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:hsa03037]
    157657 (CFAP418)
Cilium and associated proteins [BR:hsa03037]
 Primary cilia and associated proteins
  Other primary cilia associated proteins
   157657 (CFAP418)
SSDB
Motif
Pfam: RMP
Other DBs
NCBI-GeneID: 157657
NCBI-ProteinID: NP_808880
OMIM: 614477
HGNC: 27232
Ensembl: ENSG00000156172
Pharos: Q96NL8(Tbio)
UniProt: Q96NL8
Position
8:complement(95244913..95269201)
AA seq 207 aa
MAEDLDELLDEVESKFCTPDLLRRGMVEQPKGCGGGTHSSDRNQAKAKETLRSTETFKKE
DDLDSLINEILEEPNLDKKPSKLKSKSSGNTSVRASIEGLGKSCSPVYLGGSSIPCGIGT
NISWRACDHLRCIACDFLVVSYDDYMWDKSCDYLFFRNNMPEFHKLKAKLIKKKGTRAYA
CQCSWRTIEEVTDLQTDHQLRWVCGKH
NT seq 624 nt   +upstreamnt  +downstreamnt
atggcggaggacctggacgagctcttggatgaagtcgagtccaagttttgcacacctgac
cttctaagacggggtatggtcgagcagcccaaaggctgcggcggcggcacccacagtagc
gaccggaaccaagccaaggcgaaagagacgctcagatcaacagaaacatttaaaaaagaa
gatgatcttgacagtcttattaatgaaatacttgaagagcccaacttggacaaaaaaccc
tctaaattaaaatctaaatcttcaggtaacacatctgtcagagcttccattgaaggcctt
ggtaaaagttgcagtccggtgtaccttggtggaagctctattccatgtgggattggaaca
aatatttcatggagagcatgtgaccatctgcgttgtatagcctgtgatttcttggtagtc
agctatgatgactatatgtgggacaaatcgtgtgattatctgtttttcaggaacaacatg
ccagaatttcacaaattaaaagcaaagttgataaagaagaaaggaacacgggcatatgcc
tgccagtgtagctggagaactattgaagaagtgactgaccttcagacagatcatcagctt
cgctgggtttgtggtaaacattaa

DBGET integrated database retrieval system