KEGG   Homo sapiens (human): 157724
Entry
157724            CDS       T01001                                 

Symbol
SLC7A13, AGT-1, AGT1, XAT2
Name
(RefSeq) solute carrier family 7 member 13
  KO
K13870  solute carrier family 7 (L-type amino acid transporter), member 12/13
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    157724 (SLC7A13)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC7: Cationic amino acid transporter/glycoprotein-associated
   157724 (SLC7A13)
SSDB
Motif
Pfam: AA_permease_2 AA_permease
Other DBs
NCBI-GeneID: 157724
NCBI-ProteinID: NP_620172
OMIM: 617256
HGNC: 23092
Ensembl: ENSG00000164893
Vega: OTTHUMG00000163663
Pharos: Q8TCU3(Tdark)
UniProt: Q8TCU3
Position
8q21.3
AA seq 470 aa
MDRGEKIQLKRVFGYWWGTSFLLINIIGAGIFVSPKGVLAYSCMNVGVSLCVWAGCAILA
MTSTLCSAEISISFPCSGAQYYFLKRYFGSTVAFLNLWTSLFLGSGVVAGQALLLAEYSI
QPFFPSCSVPKLPKKCLALAMLWIVGILTSRGVKEVTWLQIASSVLKVSILSFISLTGVV
FLIRGKKENVERFQNAFDAELPDISHLIQAIFQGYFAYSGGACFTLIAGELKKPRTTIPK
CIFTALPLVTVVYLLVNISYLTVLTPREILSSDAVAITWADRAFPSLAWIMPFAISTSLF
SNLLISIFKSSRPIYLASQEGQLPLLFNTLNSHSSPFTAVLLLVTLGSLAIILTSLIDLI
NYIFFTGSLWSILLMIGILRRRYQEPNLSIPYKVFLSFPLATIVIDVGLVVIPLVKSPNV
HYVYVLLLVLSGLLFYIPLIHFKIRLAWFEKMTCYLQLLFNICLPDVSEE
NT seq 1413 nt   +upstreamnt  +downstreamnt
atggatagaggggagaaaatacagctcaagagagtgtttggatattggtggggcacaagt
tttttgcttattaatatcattggtgcaggaatttttgtgtcccccaaaggtgtgttggca
tactcttgcatgaacgtgggagtctccctgtgcgtttgggctggctgtgccatactggcc
atgacatcaactctttgctctgcagagataagtataagcttcccatgcagtggagctcaa
tactattttctcaagagatactttggctccacggttgcttttttgaatctctggacatcc
ttgtttctggggtcaggggtagttgctggccaagctctgctccttgctgagtacagcatc
cagcctttttttcccagctgctctgtcccaaagctgcctaagaaatgtctggcattggcc
atgttgtggattgtaggaattctgacttctcgtggtgtgaaagaagtgacttggcttcag
atagctagctcagtgctgaaagtgtccatacttagcttcatttccctaactggagtagtg
ttcctgataagagggaaaaaggagaatgtagaacgatttcagaatgcttttgatgctgaa
cttccagatatctctcaccttatacaagccatcttccaaggatattttgcatattcaggc
ggggcatgctttacacttatagcaggggagctgaagaagcccagaacaacaattcccaaa
tgcatatttactgcgttacctctggtgactgtagtttatttactggttaacatttcctat
ctgactgttctgacacccagggaaattctctcttcagatgctgtagctatcacatgggct
gatcgagcttttccctcattagcatggattatgccttttgctatttctacctcattattt
agcaaccttctgatttctatatttaaatcatcgagaccaatatatcttgcaagccaagag
ggccagctgcctttgctatttaatacacttaatagtcactcttctccatttacagctgtg
ctactacttgtcactttgggatcccttgcaattatcttaacaagtctaattgatttgata
aactatatttttttcacgggttcattatggtctatattattaatgataggaatactaagg
cggagataccaggaacccaatctatctataccttataaggtgtttttgtcatttccatta
gcaacaatagtcatcgacgtgggcttggttgtgataccattggtaaagtctccaaatgtg
cattatgtctacgtgcttctgttagttctcagcggattactattttacatacctttaata
cattttaaaataagattggcttggtttgagaagatgacttgctatttacaattactattt
aatatttgcctccctgatgtgtctgaggaatag

DBGET integrated database retrieval system