KEGG   Homo sapiens (human): 157773
Entry
157773            CDS       T01001                                 

Gene name
C8orf48
Definition
(RefSeq) chromosome 8 open reading frame 48
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: DUF4606 zf-RING_7
Other DBs
NCBI-GeneID: 157773
NCBI-ProteinID: NP_001007091
HGNC: 26345
Ensembl: ENSG00000164743
Vega: OTTHUMG00000165482
Pharos: Q96LL4(Tdark)
UniProt: Q96LL4
Position
8p22
AA seq 319 aa
MAICPELAQTDKSALANLSDETETLKNSTDEVQTSSSFSSSGGRQSSPLTSGSKLEREKQ
TPSLEQGDTQSELLDYKNYEKKLSKKWINYLKLKDSNFERHQPDTKLPTEITRVSDEELN
ALQSYCTMKINLIHRRGDSKKKTSSRHKKLHLGLDVEASERDAFSCTVPDELLNRIYFKN
MRTTPKQEAAAKQHISYQCPYCNRKRAELALSAFLKQKKTLLESFLLQERIDEHLHTKDF
LTRIGEAHQDFPRLSDDPRIIWKRLTEKSHIRYSGFERSETEQKLQRDGNSACHLPFSLP
FLKRLTLIKPELVIVNDNV
NT seq 960 nt   +upstreamnt  +downstreamnt
atggccatctgcccagaattggcccaaacggacaaaagtgctcttgcaaacctttctgat
gagactgagactttgaagaactctactgatgaggtacagacttccagctcattcagctcc
tctggaggacggcagtcctcgcccctgacctctgggagcaaactggagagggaaaagcag
actccaagcttggaacaaggagacacacaatctgagcttttggactataaaaattatgaa
aagaagttgagtaaaaaatggatcaactacctcaagctcaaagactctaactttgaacgg
caccaaccagacaccaaacttccaacagaaatcactcgggtatcagatgaagaattgaat
gccctgcagtcttattgcaccatgaagataaatttgattcatcgtagaggggattctaag
aagaagacgagcagcagacataaaaagctgcatcttggattggatgtagaggcttcagag
agagatgcctttagttgtactgtacccgatgaacttttgaacagaatctactttaaaaac
atgaggacaacgccaaaacaggaggcagcagctaagcaacacatatcttatcagtgtccc
tattgtaacaggaaaagagcggagctggccctgtctgcctttctgaaacaaaagaagact
ttactggagtcatttctactccaagagagaatagatgaacatcttcataccaaagacttt
ctcacccgtattggagaagcacatcaagactttcccaggctttcagatgaccccagaata
atctggaaaagactgactgagaaaagtcatatcagatactctggttttgaaagatcagag
acagagcagaagttgcagcgagatggaaatagtgcttgtcatttaccattttctctgcca
tttctcaagcgacttactctaatcaaaccagagctggtgattgttaatgataatgtgtaa

DBGET integrated database retrieval system