KEGG   Homo sapiens (human): 157807
Entry
157807            CDS       T01001                                 
Symbol
CLVS1, C6orf212L, CRALBPL, RLBP1L1
Name
(RefSeq) clavesin 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: CRAL_TRIO CRAL_TRIO_2 CRAL_TRIO_N
Other DBs
NCBI-GeneID: 157807
NCBI-ProteinID: NP_775790
OMIM: 611292
HGNC: 23139
Ensembl: ENSG00000177182
Pharos: Q8IUQ0(Tbio)
UniProt: Q8IUQ0
Position
8:60964848..61501629
AA seq 354 aa
MGPVSLLPKYQKLNTWNGDLAKMTHLQAGLSPETIEKARLELNENPDVLHQDIQQVRDMI
ITRPDIGFLRTDDAFILRFLRARKFHQADAFRLLAQYFQYRQLNLDMFKNFKADDPGIKR
ALIDGFPGVLENRDHYGRKILLLFAANWDQSRNSFTDILRAILLSLEVLIEDPELQINGF
ILIIDWSNFSFKQASKLTPSILKLAIEGLQDSFPARFGGVHFVNQPWYIHALYTLIKPFL
KDKTRKRIFLHGNNLNSLHQLIHPEFLPSEFGGTLPPYDMGTWARTLLGPDYSDENDYTH
TSYNAMHVKHTSSNLERECSPKLMKRSQSVVEAGTLKHEEKGENENTQPLLALD
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgggaccagtctctcttcttccaaaatatcagaagttaaacacttggaacggagatttg
gccaagatgacccatttacaggctggactcagtccagagactatagagaaagctcgcctg
gaactgaatgaaaaccccgatgttttacatcaggatattcagcaagtcagggacatgatc
atcaccaggcctgacattggatttttacgtacagatgatgccttcatcctgagatttctc
cgagccaggaagtttcaccaagcggatgcctttagactcctggctcagtatttccagtac
cgccagctaaacctggacatgttcaaaaacttcaaggcagatgatcccggcattaagagg
gctctgatcgatgggttccccggggtgctggaaaaccgagaccattacggcaggaagatt
cttttgctgtttgcagccaattgggatcagagtaggaactccttcacagacatccttcgt
gccatcctgctgtcattggaagtcctaatcgaagatccggagcttcagataaatggcttc
attttaattatagactggagtaatttttccttcaaacaagcctccaaactgacaccttca
atccttaaactggccattgaagggttgcaggacagctttcctgcccgctttggaggagtc
cactttgtcaaccagccctggtacattcatgccctctacacactcatcaagccatttctt
aaagacaagaccaggaaacggattttcctgcatggaaacaatttaaacagccttcaccag
ctaatacaccctgaatttttgccctctgaatttggaggaactcttcctccttatgacatg
ggaacttgggcccggacgttactcggtcccgactacagcgatgaaaatgactatactcac
acatcctataatgcaatgcacgtgaagcatacgtcctcgaatctggagagagaatgctca
cccaagctgatgaaaagatctcagtctgtggtagaagctgggaccctgaaacatgaggag
aagggagagaatgagaacacccagccactcctggctctggactga

DBGET integrated database retrieval system