KEGG   Homo sapiens (human): 157855Help
Entry
157855            CDS       T01001                                 

Gene name
KCNU1, KCNMC1, KCa5, KCa5.1, Kcnma3, Slo3
Definition
(RefSeq) potassium calcium-activated channel subfamily U member 1
  KO
K05274  potassium large conductance calcium-activated channel subfamily M alpha member 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    157855 (KCNU1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    157855 (KCNU1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    157855 (KCNU1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    157855 (KCNU1)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, calcium- and sodium-activated (KCa/KNa)
   157855 (KCNU1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BK_channel_a Ion_trans Ion_trans_2
Motif
Other DBs
NCBI-GeneID: 157855
NCBI-ProteinID: NP_001027006
OMIM: 615215
HGNC: 18867
Ensembl: ENSG00000215262
Vega: OTTHUMG00000163981
Pharos: A8MYU2(Tbio)
UniProt: A8MYU2
Structure
PDB: 

Position
8p11.23
AA seq 1149 aa AA seqDB search
MFQTKLRNETWEDLPKMSCTTEIQAAFILSSFVTFFSGLIILLIFRLIWRSVKKWQIIKG
TGIILELFTSGTIARSHVRSLHFQGQFRDHIEMLLSAQTFVGQVLVILVFVLSIGSLIIY
FINSADPVGSCSSYEDKTIPIDLVFNAFFSFYFGLRFMAADDKIKFWLEMNSIVDIFTIP
PTFISYYLKSNWLGLRFLRALRLLELPQILQILRAIKTSNSVKFSKLLSIILSTWFTAAG
FIHLVENSGDPWLKGRNSQNISYFESIYLVMATTSTVGFGDVVAKTSLGRTFIMFFTLGS
LILFANYIPEMVELFANKRKYTSSYEALKGKKFIVVCGNITVDSVTAFLRNFLRDKSGEI
NTEIVFLGETPPSLELETIFKCYLAYTTFISGSAMKWEDLRRVAVESAEACLIIANPLCS
DSHAEDISNIMRVLSIKNYDSTTRIIIQILQSHNKVYLPKIPSWNWDTGDNIICFAELKL
GFIAQGCLVPGLCTFLTSLFVEQNKKVMPKQTWKKHFLNSMKNKILTQRLSDDFAGMSFP
EVARLCFLKMHLLLIAIEYKSLFTDGFCGLILNPPPQVRIRKNTLGFFIAETPKDVRRAL
FYCSVCHDDVFIPELITNCGCKSRSRQHITVPSVKRMKKCLKGISSRISGQDSPPRVSAS
TSSISNFTTRTLQHDVEQDSDQLDSSGMFHWCKPTSLDKVTLKRTGKSKYKFRNHIVACV
FGDAHSAPMGLRNFVMPLRASNYTRKELKDIVFIGSLDYLQREWRFLWNFPQIYILPGCA
LYSGDLHAANIEQCSMCAVLSPPPQPSSNQTLVDTEAIMATLTIGSLQIDSSSDPSPSVS
EETPGYTNGHNEKSNCRKVPILTELKNPSNIHFIEQLGGLEGSLQETNLHLSTAFSTGTV
FSGSFLDSLLATAFYNYHVLELLQMLVTGGVSSQLEQHLDKDKVYGVADSCTSLLSGRNR
CKLGLLSLHETILSDVNPRNTFGQLFCGSLDLFGILCVGLYRIIDEEELNPENKRFVITR
PANEFKLLPSDLVFCAIPFSTACYKRNEEFSLQKSYEIVNKASQTTETHSDTNCPPTIDS
VTETLYSPVYSYQPRTNSLSFPKQIAWNQSRTNSIISSQIPLGDNAKENERKTSDEVYDE
DPFAYSEPL
NT seq 3450 nt NT seq  +upstreamnt  +downstreamnt
atgtttcagactaagctacgaaatgaaacttgggaagacttgccaaaaatgtcctgcaca
actgagatccaagcagcattcattctctcttcctttgtgaccttcttcagtggactcatc
atcctgttgatcttcaggctgatctggagatctgttaaaaaatggcaaatcatcaaggga
acaggaattatcttggaactgttcacatcaggtaccatcgctaggagccatgtaagaagc
ctccacttccagggacaatttcgtgatcatatagaaatgttgctttcagcccagaccttt
gtggggcaagtgttggtgatccttgtctttgtactaagcattgggtctcttataatctat
ttcatcaattctgctgaccctgttggaagctgttcatcatatgaagacaaaaccattcct
attgatttggttttcaatgctttctttagtttctattttggattgaggtttatggcagct
gatgacaagatcaagttctggctggagatgaattcaatcgtagacatctttaccatccca
ccaacctttatttcttattatttgaagagcaattggctaggtttaaggttcctaagagcc
ttgcgcctgctagaactccctcaaatcttgcaaattctacgagccatcaagaccagtaac
tcagtgaagttttccaaactgctgtcaataattctcagtacctggttcacagctgcggga
ttcattcacctggtggaaaattctggtgatccctggctcaaaggtagaaattcacagaat
atatcatattttgagtcaatttacctggtcatggcaacaacgtcaaccgttggatttgga
gatgtggtagccaagacatccttaggacggaccttcatcatgttcttcacactggggagt
ttgatattatttgcgaactatatacctgaaatggtggaactgtttgctaacaagaggaaa
tacaccagttcctatgaagcactcaaaggaaagaagtttattgtggtctgtggaaacatc
actgtggacagtgtgaccgctttcctgaggaatttcctccgcgacaagtcaggagagatc
aacactgaaattgttttcctgggagaaacccctccttctttggaacttgaaaccatattt
aaatgctacttggcctacacaacgttcatttctggatctgcaatgaagtgggaggatctg
aggcgagttgcggtggaatctgcagaggcatgcctgattatagccaatcctttgtgcagt
gattcccatgctgaagatatttccaacattatgagggtgctctctatcaagaactatgat
tctaccaccagaatcatcatacagatactgcaatcccataacaaggtttatctgccaaag
attcccagctggaactgggacaccggagacaacatcatctgctttgctgaattaaaactt
ggatttatcgcccaaggctgtttggtgccaggcttgtgtaccttcctaacatctctattt
gtggagcaaaacaaaaaggttatgcctaaacagacctggaagaaacacttcttgaatagc
atgaaaaacaaaattctgacccaacgtctctctgatgactttgctggaatgagctttcct
gaagttgcccggctctgctttctgaagatgcacctcctgttgatagccatcgaatacaag
tccctctttacggatggtttctgtggtctgatactaaatccacctccacaagtgaggata
cgtaagaacacattagggttctttattgctgaaactccaaaggacgtcagaagagccttg
ttttactgttcagtctgtcatgatgatgtgttcattcctgagctaattacaaactgtggc
tgcaaaagcagaagccggcagcacatcacagtgccatcggtaaagagaatgaaaaaatgt
ctgaagggaatctcctctcgtatatcagggcaggattctccgccaagggtatctgcaagc
acttcgagcatatcaaacttcaccaccaggactcttcaacatgatgtagaacaagattct
gaccagcttgatagcagtgggatgtttcactggtgcaaaccaacctctttggacaaggtg
actctgaaacgaactggcaagtcaaagtataagtttcggaaccatattgtagcatgtgta
tttggagatgcccactcagccccgatggggcttcggaactttgtaatgcccttgagagcc
agcaactataccaggaaggagctgaaggacatagtgttcattgggtctctggactatcta
cagagagaatggcgatttctctggaattttccccagatatacattctgcctggatgtgca
ctttattctggagacctccatgcggccaacatagagcaatgctccatgtgtgctgtcttg
tcccccccaccccagccatcaagcaaccagactttggtagacacagaagccatcatggca
accctcaccatcggatccttgcaaattgactcctcctctgacccgtcaccctcagtgtca
gaggagactccaggttacacaaatggacataatgagaaatcaaactgccgaaaagtccct
atccttactgaactgaaaaatccttccaacattcactttattgaacagcttggtggactg
gaagggtccctccaagaaacaaatctgcatctcagcactgccttttctacgggcactgtt
ttttccggcagcttcttggattctctgctggccacggccttctacaattatcatgtcctg
gaattgcttcagatgctggtgacaggaggagtaagttctcagctggaacaacatttagat
aaggataaagtctatggtgtggcagatagctgcacgtcgctcttgtctggaagaaaccgg
tgtaagctggggcttctgtccttacacgaaaccattttatcagacgttaatccaagaaac
acctttggacaactgttctgtggctcattagatctttttggaatcctgtgtgttggctta
taccgaataattgatgaagaggagctcaacccagaaaacaaaaggtttgtgatcacccgg
ccagccaatgagttcaagctgctgccttcagatcttgtgttttgtgccatacccttcagc
actgcttgttataaaaggaatgaagagttctcattgcaaaagtcatatgaaattgtaaat
aaagcatcacagacaacagagacacattcagacacaaattgtcctcccaccattgattca
gttactgagacattgtattcaccagtctattcttaccagccgagaactaactccctctct
tttcctaagcaaatagcatggaatcagagtagaacaaacagtattatatcatctcagata
cctttaggtgacaatgcaaaagaaaatgaaaggaaaacttcagatgaggtttatgatgag
gatccctttgcatattcagagccactatag

DBGET integrated database retrieval system