KEGG   Homo sapiens (human): 1579Help
Entry
1579              CDS       T01001                                 

Gene name
CYP4A11, CP4Y, CYP4A2, CYP4AII, CYPIVA11
Definition
(RefSeq) cytochrome P450 family 4 subfamily A member 11
  KO
K07425  long-chain fatty acid omega-monooxygenase [EC:1.14.14.80]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00071  Fatty acid degradation
hsa00590  Arachidonic acid metabolism
hsa00830  Retinol metabolism
hsa01100  Metabolic pathways
hsa03320  PPAR signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    1579 (CYP4A11)
   00590 Arachidonic acid metabolism
    1579 (CYP4A11)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    1579 (CYP4A11)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    1579 (CYP4A11)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    1579 (CYP4A11)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    1579 (CYP4A11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:hsa00199]
    1579 (CYP4A11)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.80  long-chain fatty acid omega-monooxygenase
     1579 (CYP4A11)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP4 family
   1579 (CYP4A11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 1579
NCBI-ProteinID: NP_000769
OMIM: 601310
HGNC: 2642
Ensembl: ENSG00000187048
Vega: OTTHUMG00000008020
Pharos: Q02928(Tbio)
UniProt: Q02928
Position
1p33
AA seq 519 aa AA seqDB search
MSVSVLSPSRLLGDVSGILQAASLLILLLLLIKAVQLYLHRQWLLKALQQFPCPPSHWLF
GHIQELQQDQELQRIQKWVETFPSACPHWLWGGKVRVQLYDPDYMKVILGRSDPKSHGSY
RFLAPWIGYGLLLLNGQTWFQHRRMLTPAFHYDILKPYVGLMADSVRVMLDKWEELLGQD
SPLEVFQHVSLMTLDTIMKCAFSHQGSIQVDRNSQSYIQAISDLNNLVFSRVRNAFHQND
TIYSLTSAGRWTHRACQLAHQHTDQVIQLRKAQLQKEGELEKIKRKRHLDFLDILLLAKM
ENGSILSDKDLRAEVDTFMFEGHDTTASGISWILYALATHPKHQERCREEIHSLLGDGAS
ITWNHLDQMPYTTMCIKEALRLYPPVPGIGRELSTPVTFPDGRSLPKGIMVLLSIYGLHH
NPKVWPNPEVFDPFRFAPGSAQHSHAFLPFSGGSRNCIGKQFAMNELKVATALTLLRFEL
LPDPTRIPIPIARLVLKSKNGIHLRLRRLPNPCEDKDQL
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtctctgtgctgagccccagcagactcctgggtgatgtctctggaatcctccaa
gcggcctccctgctcattctgcttctgctgctgatcaaggcagttcagctctacctgcac
aggcagtggctgctcaaagccctccagcagttcccgtgccctccctcccactggctcttc
gggcacatccaggagctccaacaggaccaggagctacaacggattcagaaatgggtggag
acattcccaagtgcctgtcctcattggctatggggaggcaaagttcgtgtccagctctat
gaccctgactatatgaaggtgattctggggagatcagacccgaaatcccatggttcctac
agattcctggctccatggattgggtacggcttgctcctgttgaatgggcagacatggttc
cagcatcgacggatgctgaccccagccttccactatgacatcctgaagccctatgtgggg
ctcatggcagactctgtacgagtgatgctggacaaatgggaagagctccttggccaggat
tcccctctggaggtctttcagcacgtctccttgatgaccctggacaccatcatgaagtgt
gccttcagccatcagggcagcatccaggtggacaggaattctcagtcctacatacaggcc
attagtgacctgaacaacctggttttttcccgtgtgaggaatgcctttcaccagaatgac
accatctacagcctgacctctgctggccgctggacacaccgcgcctgccagctggcccat
cagcacacagaccaagtgatccaactgaggaaggctcaactacagaaggagggggagctg
gagaagatcaagaggaagaggcatttggattttctggatatcctcctcttggccaaaatg
gagaatgggagcatcttgtcagacaaggacctccgtgctgaggtggacacgttcatgttt
gagggccacgacaccacagccagtgggatctcctggatcctctatgctctggccacacac
cccaagcatcaggagaggtgccgggaggagatccacagcctcctgggtgatggagcctcc
atcacctggaaccacctggaccagatgccctacaccaccatgtgcattaaggaggcactg
aggctctacccaccggtgccaggcattggcagagagctcagcactcccgtcaccttccct
gatgggcgctccttgcccaaaggtatcatggtcctcctctccatttatggccttcaccac
aacccaaaagtgtggcccaacccagaggtgtttgaccctttccgttttgcaccgggttct
gctcaacacagccacgctttcctgcccttctcaggaggatcaaggaactgcatcgggaaa
caatttgccatgaacgagctgaaggtggccacggccctgaccctgctccgctttgagctg
ctgcctgatcccaccaggatccccatccccattgcacgacttgtgttgaaatccaaaaat
ggaatccacctgcgtctcaggaggctccctaacccttgtgaagacaaggaccagctttga

KEGG   Homo sapiens (human): 284541Help
Entry
284541            CDS       T01001                                 

Gene name
CYP4A22
Definition
(RefSeq) cytochrome P450 family 4 subfamily A member 22
  KO
K07425  long-chain fatty acid omega-monooxygenase [EC:1.14.14.80]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00071  Fatty acid degradation
hsa00590  Arachidonic acid metabolism
hsa00830  Retinol metabolism
hsa01100  Metabolic pathways
hsa03320  PPAR signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    284541 (CYP4A22)
   00590 Arachidonic acid metabolism
    284541 (CYP4A22)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    284541 (CYP4A22)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    284541 (CYP4A22)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    284541 (CYP4A22)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    284541 (CYP4A22)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:hsa00199]
    284541 (CYP4A22)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.80  long-chain fatty acid omega-monooxygenase
     284541 (CYP4A22)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP4 family
   284541 (CYP4A22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450 DUF2451 Proton_antipo_M
Motif
Other DBs
NCBI-GeneID: 284541
NCBI-ProteinID: NP_001010969
OMIM: 615341
HGNC: 20575
Ensembl: ENSG00000162365
Vega: OTTHUMG00000007845
Pharos: Q5TCH4(Tbio)
UniProt: Q5TCH4
Position
1p33
AA seq 519 aa AA seqDB search
MSVSVLSPSRRLGGVSGILQVTSLLILLLLLIKAAQLYLHRQWLLKALQQFPCPPSHWLF
GHIQEFQHDQELQRIQERVKTFPSACPYWIWGGKVRVQLYDPDYMKVILGRSDPKSHGSY
KFLAPRIGYGLLLLNGQTWFQHRRMLTPAFHNDILKPYVGLMADSVRVMLDKWEELLGQD
SPLEVFQHVSLMTLDTIMKSAFSHQGSIQVDRNSQSYIQAISDLNSLVFCCMRNAFHEND
TIYSLTSAGRWTHRACQLAHQHTDQVIQLRKAQLQKEGELEKIKRKRHLDFLDILLLAKM
ENGSILSDKDLRAEVDTFMFEGHDTTASGISWILYALATHPKHQERCREEIHGLLGDGAS
ITWNHLDQMPYTTMCIKEALRLYPPVPGIGRELSTPVTFPDGRSLPKGIMVLLSIYGLHH
NPKVWPNLEVFDPSRFAPGSAQHSHAFLPFSGGSRNCIGKQFAMNQLKVARALTLLRFEL
LPDPTRIPIPMARLVLKSKNGIHLRLRRLPNPCEDKDQL
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtctctgtcctgagccccagcagacgcctgggtggtgtctccgggatcctccaa
gtgacctccctgctcattctgcttctgctgctgatcaaggcagctcagctctacctgcat
aggcagtggctgctcaaagccctccagcagttcccgtgccctccctcccactggctcttc
gggcacatccaggagttccaacacgaccaggagctacaacggattcaggaacgggtgaag
acattcccaagtgcctgtccttattggatatggggaggcaaagttcgtgtccagctctat
gaccctgactatatgaaggtgattctggggagatcagacccgaaatcccatggatcctac
aaattcctggctccacggattgggtacggcttgctcctgttgaatgggcagacatggttc
cagcatcgacggatgctgaccccagccttccacaatgacatcctgaagccatacgtgggg
ctcatggcagactctgtacgagtgatgctggacaaatgggaagagctccttggccaggat
tcccctctggaggtctttcagcacgtctccttgatgaccctggacaccatcatgaagagt
gccttcagccatcagggcagcatccaggtggacaggaattctcagtcctacatccaggcc
attagtgacctgaacagcctggttttttgctgtatgaggaatgcctttcatgagaatgac
accatctacagcctgacctctgctggccgctggacacaccgcgcctgccagctggcccat
cagcacacagaccaagtgatccaactgaggaaggctcaactacagaaggagggggagctg
gagaagatcaagaggaagaggcacttggattttctggacatcctcctcttggccaaaatg
gagaatgggagcatcttgtcagacaaggacctccgtgctgaggtggacacgttcatgttt
gagggccacgacaccacagccagtgggatctcctggatcctctatgctctggccacacac
cccaagcatcaggagaggtgccgggaggagatccatggcctcctgggtgatggagcctcc
atcacctggaaccacctggaccagatgccctacaccaccatgtgcattaaggaggcactg
aggctctacccaccggtgccaggcattggaagagagctcagcactcccgtcaccttccct
gatgggcgctccttgcccaaaggtatcatggtcctcctctccatttatggccttcaccac
aacccaaaagtgtggcccaacctagaggtgtttgacccttcccgttttgcaccgggttct
gctcaacacagccacgctttcctgcccttctcaggaggatcaaggaactgcatcgggaaa
caatttgccatgaaccagctgaaggtggccagggccctgaccctgctccgctttgagctg
ctgcctgatcccaccaggatccccatccccatggcacgacttgtgttgaaatccaaaaat
ggaatccacctgcgtctcaggaggctccctaacccttgtgaagacaaggaccagctttga

DBGET integrated database retrieval system