KEGG   Homo sapiens (human): 158046
Entry
158046            CDS       T01001                                 
Symbol
NXNL2, C9orf121, RDCVF2, RdCVF2L
Name
(RefSeq) nucleoredoxin like 2
  KO
K17609  nucleoredoxin [EC:1.8.1.8]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    158046 (NXNL2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.8  protein-disulfide reductase
     158046 (NXNL2)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Other PP2-interacting proteins
     158046 (NXNL2)
SSDB
Motif
Pfam: Thioredoxin_8 Redoxin AhpC-TSA Thioredoxin
Other DBs
NCBI-GeneID: 158046
NCBI-ProteinID: NP_001155097
OMIM: 615299
HGNC: 30482
Ensembl: ENSG00000130045
Position
9:88535178..88584510
AA seq 156 aa
MVDILGERHLVTCKGATVEAEAALQNKVVALYFAAARCAPSRDFTPLLCDFYTALVAEAR
RPAPFEVVFVSADGSSQEMLDFMRELHGAWLALPFHDPYRHELRKRYNVTAIPKLVIVKQ
NGEVITNKGRKQIRERGLACFQDWVEAADIFQNFSV
NT seq 471 nt   +upstreamnt  +downstreamnt
atggttgacattctgggcgagcggcacctggtgacctgtaagggcgcgacggtggaggcc
gaggcggcgctgcagaacaaggtggtggcactgtacttcgcggcggcccggtgcgcgccg
agccgcgacttcacgccgctgctctgcgacttctatacggcgctggtggccgaggcgcgg
cggcccgcgcccttcgaagtggtcttcgtgtcagccgacggcagctcccaggagatgctg
gacttcatgcgcgagctgcatggcgcctggctggcgctgcccttccacgacccctaccgg
catgagctgaggaagaggtacaacgtcacagccatccccaagcttgtgattgtgaaacaa
aatggggaggtcatcaccaacaaagggcggaagcagatccgggaacgggggttggcctgc
ttccaggactgggtggaggcggccgatatcttccagaatttctccgtttga

DBGET integrated database retrieval system