KEGG   Homo sapiens (human): 1581Help
Entry
1581              CDS       T01001                                 

Gene name
CYP7A1, CP7A, CYP7, CYPVII
Definition
(RefSeq) cytochrome P450 family 7 subfamily A member 1
  KO
K00489  cholesterol 7alpha-monooxygenase [EC:1.14.14.23]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00120  Primary bile acid biosynthesis
hsa00140  Steroid hormone biosynthesis
hsa01100  Metabolic pathways
hsa03320  PPAR signaling pathway
hsa04976  Bile secretion
hsa04979  Cholesterol metabolism
Module
hsa_M00104  Bile acid biosynthesis, cholesterol => cholate/chenodeoxycholate
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00120 Primary bile acid biosynthesis
    1581 (CYP7A1)
   00140 Steroid hormone biosynthesis
    1581 (CYP7A1)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    1581 (CYP7A1)
  Digestive system
   04976 Bile secretion
    1581 (CYP7A1)
   04979 Cholesterol metabolism
    1581 (CYP7A1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.23  cholesterol 7alpha-monooxygenase
     1581 (CYP7A1)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP7 family
   1581 (CYP7A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450 FANCF
Motif
Other DBs
NCBI-GeneID: 1581
NCBI-ProteinID: NP_000771
OMIM: 118455
HGNC: 2651
Ensembl: ENSG00000167910
Vega: OTTHUMG00000164301
Pharos: P22680(Tbio)
UniProt: P22680
Structure
PDB: 

Position
8q12.1
AA seq 504 aa AA seqDB search
MMTTSLIWGIAIAACCCLWLILGIRRRQTGEPPLENGLIPYLGCALQFGANPLEFLRANQ
RKHGHVFTCKLMGKYVHFITNPLSYHKVLCHGKYFDWKKFHFATSAKAFGHRSIDPMDGN
TTENINDTFIKTLQGHALNSLTESMMENLQRIMRPPVSSNSKTAAWVTEGMYSFCYRVMF
EAGYLTIFGRDLTRRDTQKAHILNNLDNFKQFDKVFPALVAGLPIHMFRTAHNAREKLAE
SLRHENLQKRESISELISLRMFLNDTLSTFDDLEKAKTHLVVLWASQANTIPATFWSLFQ
MIRNPEAMKAATEEVKRTLENAGQKVSLEGNPICLSQAELNDLPVLDSIIKESLRLSSAS
LNIRTAKEDFTLHLEDGSYNIRKDDIIALYPQLMHLDPEIYPDPLTFKYDRYLDENGKTK
TTFYCNGLKLKYYYMPFGSGATICPGRLFAIHEIKQFLILMLSYFELELIEGQAKCPPLD
QSRAGLGILPPLNDIEFKYKFKHL
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgatgaccacatctttgatttgggggattgctatagcagcatgctgttgtctatggctt
attcttggaattaggagaaggcaaacgggtgaaccacctctagagaatggattaattcca
tacctgggctgtgctctgcaatttggtgccaatcctcttgagttcctcagagcaaatcaa
aggaaacatggtcatgtttttacctgcaaactaatgggaaaatatgtccatttcatcaca
aatcccttgtcataccataaggtgttgtgccacggaaaatattttgattggaaaaaattt
cactttgctacttctgcgaaggcatttgggcacagaagcattgacccgatggatggaaat
accactgaaaacataaacgacactttcatcaaaaccctgcagggccatgccttgaattcc
ctcacggaaagcatgatggaaaacctccaacgtatcatgagacctccagtctcctctaac
tcaaagaccgctgcctgggtgacagaagggatgtattctttctgctaccgagtgatgttt
gaagctgggtatttaactatctttggcagagatcttacaaggcgggacacacagaaagca
catattctaaacaatcttgacaacttcaagcaattcgacaaagtctttccagccctggta
gcaggcctccccattcacatgttcaggactgcgcacaatgcccgggagaaactggcagag
agcttgaggcacgagaacctccaaaagagggaaagcatctcagaactgatcagcctgcgc
atgtttctcaatgacactttgtccacctttgatgatctggagaaggccaagacacacctc
gtggtcctctgggcatcgcaagcaaacaccattccagcgactttctggagtttatttcaa
atgattaggaacccagaagcaatgaaagcagctactgaagaagtgaaaagaacattagag
aatgctggtcaaaaagtcagcttggaaggcaatcctatttgtttgagtcaagcagaactg
aatgacctgccagtattagatagtataatcaaggaatcgctgaggctttccagtgcctcc
ctcaacatccggacagctaaggaggatttcactttgcaccttgaggacggttcctacaac
atccgaaaagatgacatcatagctctttacccacagttaatgcacttagatccagaaatc
tacccagaccctttgacttttaaatatgataggtatcttgatgaaaacgggaagacaaag
actaccttctattgtaatggactcaagttaaagtattactacatgccctttggatcggga
gctacaatatgtcctggaagattgttcgctatccacgaaatcaagcaatttttgattctg
atgctttcttattttgaattggagcttatagagggccaagctaaatgtccacctttggac
cagtcccgggcaggcttgggcattttgccgccattgaatgatattgaatttaaatataaa
ttcaagcatttgtga

DBGET integrated database retrieval system