KEGG   Homo sapiens (human): 158219Help
Entry
158219            CDS       T01001                                 

Gene name
TTC39B, C9orf52
Definition
(RefSeq) tetratricopeptide repeat domain 39B
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF3808 TPR_12 TPR_8 TPR_19 TPR_1 TPR_2 TPR_6 TPR_14 TPR_7 CNDH2_N
Motif
Other DBs
NCBI-GeneID: 158219
NCBI-ProteinID: NP_689787
OMIM: 613574
HGNC: 23704
Ensembl: ENSG00000155158
Vega: OTTHUMG00000019581
Pharos: Q5VTQ0(Tbio)
UniProt: Q5VTQ0
Position
9p22.3
AA seq 682 aa AA seqDB search
MDAVLACRLRGRGNRVAALRPRPRPGGSAGPSPFALLCAGLSPEPRAGVGSEFPAWFLGG
SSQRRNMALLGSRAELEADEDVFEDALETISISSHSDMATSSLHFASCDTQQAPRQRGAS
TVSSSSSTKVDLKSGLEECAVALNLFLSNKFTDALELLRPWAKESMYHALGYSTIVVLQA
VLTFEQQDIQNGISAMKDALQTCQKYRKKYTVVESFSSLLSRGSLEQLSEEEMHAEICYA
ECLLQKAALTFVQDENMINFIKGGLKIRTSYQIYKECLSILHEIQKNKLQQEFFYEFEGG
VKLGSGAFNLMLSLLPARIIRLLEFIGFSGNRELGLLQLREGASGRSMRSALCCLTILAF
HTYISLILGTGEVNVAEAERLLAPFLQQFPNGSLVLFYHARIELLKGNLEEAQEVFQKCI
SVQEEWKQFHHLCYWELMWINVFQQNWMQAYYYSDLLCKESKWSKATYVFLKAAILSMLP
EEDVVATNENVVTLFRQVDSLKQRIAGKSIPTEKFAVRKARRYSASLPAPVKLILPALEM
MYVWNGFSIVSKRKDLSENLLVTVEKAEAALQSQNFNSFSVDDECLVKLLKGCCLKNLQR
PLQAELCYNHVVESEKLLKYDHYLVPFTLFELASLYKSQGEIDKAIKFLETARNNYKDYS
LESRLHFRIQAALHLWRKPSSD
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atggatgctgtgctggcctgccggctccgggggcggggaaatcgagtagctgcactcagg
ccccgcccgagacccggagggagcgccgggccgtccccttttgccctcctttgcgctggg
ctgagcccagagccgagagcaggagtcggctctgagttccctgcttggtttttgggtggc
agcagccagaggaggaatatggcgctcttaggcagccgagcggagctggaagcggacgag
gacgttttcgaagatgccttggaaaccatctcaatatcttctcactcagatatggcaaca
agcagccttcactttgcatcatgtgatacacaacaggcgcccagacagcgcggagcgtct
actgtcagcagttcatcatcaaccaaggtggatctcaagagtggcctcgaagaatgtgct
gtggcattgaacttatttctaagcaacaaatttacagacgccttagaattgcttcgcccc
tgggctaaggagagtatgtaccatgccttgggctacagtaccattgtggtgttgcaggct
gtcctgaccttcgagcaacaggacatccagaacggcatttctgccatgaaggacgcttta
caaacctgccaaaaatacaggaaaaaatacacagttgtagaatctttctcaagtcttctt
tctagaggatccctggagcaactgagtgaagaggaaatgcatgctgaaatctgttatgcc
gagtgtctcctacagaaagctgcactcacgtttgtgcaggatgaaaatatgatcaacttc
atcaaaggtggactcaaaattagaacaagttaccaaatatataaagaatgtctttctatc
ctgcatgaaattcagaagaacaaacttcagcaggaattcttctatgagtttgaagggggt
gtcaagcttggcagtggggcctttaatttgatgctgtcccttttaccagcaaggattatc
agactactagaatttattggattttctgggaatagggagttgggcctcctgcagttacgt
gaaggtgcttcaggaaggagcatgaggtctgcactgtgctgcttaaccatcttagctttt
catacttacatctccctaatacttggtacaggagaagtgaatgttgcggaagcagagcgt
ctcctggcacccttcctccagcagtttccaaatggctcactcgtgttgttttatcatgcc
cgaatagagttgctgaaagggaatcttgaagaggcacaagaagtatttcaaaaatgcatt
tcagttcaagaagaatggaaacagtttcaccatctctgctactgggagctaatgtggatt
aatgttttccaacaaaactggatgcaggcatattactattcagatctgctttgcaaagag
agtaaatggtccaaggcaacttatgtgttcttgaaagcagcaattttgagtatgcttcca
gaggaggatgtagtagcaacgaatgagaatgtggtaactttattcagacaggtggacagc
ttgaagcagagaattgccgggaaatctatccctactgagaagtttgctgtgaggaaggct
cggcgttactccgcctccttacctgcacctgtgaagctcatcttacctgccctggaaatg
atgtatgtctggaatggtttttcaatagtgagcaaaagaaaagacctttctgaaaatctg
ttagtaactgttgaaaaagctgaggcagctttacaaagtcaaaattttaacagcttctct
gtggatgatgagtgcttagtgaagttacttaaaggatgttgcctcaagaacttacagcgg
cccttgcaagctgaactatgttacaatcatgttgtggaaagtgaaaagctactgaagtat
gaccactacctagtgccgttcactctatttgaattggcatctttgtataaaagccagggg
gaaattgacaaggccataaagttcctagaaactgcaaggaacaactacaaagattactcc
ctggagtccagactacacttcagaattcaggcagctcttcacctctggagaaaaccttcc
tcagattga

DBGET integrated database retrieval system