KEGG   Homo sapiens (human): 1583Help
Entry
1583              CDS       T01001                                 

Gene name
CYP11A1, CYP11A, CYPXIA1, P450SCC
Definition
(RefSeq) cytochrome P450 family 11 subfamily A member 1
  KO
K00498  cholesterol monooxygenase (side-chain-cleaving) [EC:1.14.15.6]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00140  Steroid hormone biosynthesis
hsa01100  Metabolic pathways
hsa04913  Ovarian steroidogenesis
hsa04925  Aldosterone synthesis and secretion
hsa04927  Cortisol synthesis and secretion
hsa04934  Cushing syndrome
Module
hsa_M00107  Steroid hormone biosynthesis, cholesterol => prognenolone => progesterone
Network
nt06019  Steroid hormone biosynthesis
  Element
N00759  Steroid hormone biosynthesis, cholesterol to prognenolone/progesterone
N00763  HSD3B2 deficiency in steroid hormone biosynthesis
N00764  CYP11A1 deficiency in steroid hormone biosynthesis
Disease
H02314  Adrenal insufficiency, congenital, with 46XY sex reversal, partial or complete
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    1583 (CYP11A1)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    1583 (CYP11A1)
   04925 Aldosterone synthesis and secretion
    1583 (CYP11A1)
   04927 Cortisol synthesis and secretion
    1583 (CYP11A1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    1583 (CYP11A1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:hsa00199]
    1583 (CYP11A1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.6  cholesterol monooxygenase (side-chain-cleaving)
     1583 (CYP11A1)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP11 family
   1583 (CYP11A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 1583
NCBI-ProteinID: NP_000772
OMIM: 118485
HGNC: 2590
Ensembl: ENSG00000140459
Vega: OTTHUMG00000150716
Pharos: P05108(Tclin)
UniProt: P05108 A0A0S2Z3R3
Structure
PDB: 

Position
15q24.1
AA seq 521 aa AA seqDB search
MLAKGLPPRSVLVKGCQTFLSAPREGLGRLRVPTGEGAGISTRSPRPFNEIPSPGDNGWL
NLYHFWRETGTHKVHLHHVQNFQKYGPIYREKLGNVESVYVIDPEDVALLFKSEGPNPER
FLIPPWVAYHQYYQRPIGVLLKKSAAWKKDRVALNQEVMAPEATKNFLPLLDAVSRDFVS
VLHRRIKKAGSGNYSGDISDDLFRFAFESITNVIFGERQGMLEEVVNPEAQRFIDAIYQM
FHTSVPMLNLPPDLFRLFRTKTWKDHVAAWDVIFSKADIYTQNFYWELRQKGSVHHDYRG
ILYRLLGDSKMSFEDIKANVTEMLAGGVDTTSMTLQWHLYEMARNLKVQDMLRAEVLAAR
HQAQGDMATMLQLVPLLKASIKETLRLHPISVTLQRYLVNDLVLRDYMIPAKTLVQVAIY
ALGREPTFFFDPENFDPTRWLSKDKNITYFRNLGFGWGVRQCLGRRIAELEMTIFLINML
ENFRVEIQHLSDVGTTFNLILMPEKPISFTFWPFNQEATQQ
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctggccaagggtcttcccccacgctcagtcctggtcaaaggctgccagacctttctg
agtgcccccagggaggggctggggcgtctcagggtgcccactggcgagggagctggcatc
tccacccgcagtcctcgccccttcaatgagatcccctctcctggtgacaatggctggcta
aacctgtaccatttctggagggagacgggcacacacaaagtccaccttcaccatgtccag
aatttccagaagtatggcccgatttacagggagaagctcggcaacgtggagtcggtttat
gtcatcgaccctgaagatgtggcccttctctttaagtccgagggccccaacccagaacga
ttcctcatcccgccctgggtcgcctatcaccagtattaccagagacccataggagtcctg
ttgaagaagtcggcagcctggaagaaagaccgggtggccctgaaccaggaggtgatggct
ccagaggccaccaagaactttttgcccctgttggatgcagtgtctcgggacttcgtcagt
gtcctgcacaggcgcatcaagaaggcgggctccggaaattactcgggggacatcagtgat
gacctgttccgctttgcctttgagtccatcactaacgtcatttttggggagcgccagggg
atgctggaggaagtagtgaaccccgaggcccagcgattcattgatgccatctaccagatg
ttccacaccagcgtccccatgctcaaccttcccccagacctgttccgtctgttcaggacc
aagacctggaaggaccatgtggctgcatgggacgtgattttcagtaaagctgacatatac
acccagaacttctactgggaattgagacagaaaggaagtgttcaccacgattaccgtggc
atcctctacagactcctgggagacagcaagatgtccttcgaggacatcaaggccaacgtc
acagagatgctggcaggaggggtggacacgacgtccatgaccctgcagtggcacttgtat
gagatggcacgcaacctgaaggtgcaggatatgctgcgggcagaggtcttggctgcgcgg
caccaggcccagggagacatggccacgatgctacagctggtccccctcctcaaagccagc
atcaaggagacactaagacttcaccccatctccgtgaccctgcagagatatcttgtaaat
gacttggttcttcgagattacatgattcctgccaagacactggtgcaagtggccatctat
gctctgggccgagagcccaccttcttcttcgacccggaaaattttgacccaacccgatgg
ctgagcaaagacaagaacatcacctacttccggaacttgggctttggctggggtgtgcgg
cagtgtctgggacggcggatcgctgagctagagatgaccatcttcctcatcaatatgctg
gagaacttcagagttgaaatccaacacctcagcgatgtgggcaccacattcaacctcatt
ctgatgcctgaaaagcccatctccttcaccttctggccctttaaccaggaagcaacccag
cagtga

DBGET integrated database retrieval system