KEGG   Homo sapiens (human): 1584Help
Entry
1584              CDS       T01001                                 

Gene name
CYP11B1, CPN1, CYP11B, FHI, P450C11
Definition
(RefSeq) cytochrome P450 family 11 subfamily B member 1
  KO
K00497  steroid 11beta-monooxygenase [EC:1.14.15.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00140  Steroid hormone biosynthesis
hsa01100  Metabolic pathways
hsa04927  Cortisol synthesis and secretion
hsa04934  Cushing syndrome
Module
hsa_M00108  C21-Steroid hormone biosynthesis, progesterone => corticosterone/aldosterone
hsa_M00109  C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
Network
N00297  ACTH-cortisol signaling pathway
N00306  SF-1-mediated transcription
N00307  Mutation-inactivated DAX1 to SF-1-mediated transcription
N00308  Mutation-inactivated SF-1 to transcription
N00320  Mutation-activated PRKACA to ACTH-cortisol signaling pathway
N00321  Mutation-activated GNAS to ACTH-cortisol signaling pathway
N00322  Mutation-inactivated PRKAR1A to ACTH-cortisol signaling pathway
N00323  Mutation-inactivated PDE11A/PDE8B to ACTH-cortisol signaling pathway
N00338  Cortisol biosynthesis
N00339  Aldosterone biosynthesis
Disease
H00216  Congenital adrenal hyperplasia
H00602  Glucocorticoid-remediable aldosteronism (GRA)
H01603  Primary aldosteronism
H01633  High blood pressure
Drug target
Metyrapone (DG01166): D00410 D05019
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    1584 (CYP11B1)
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    1584 (CYP11B1)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04934 Cushing syndrome
    1584 (CYP11B1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:hsa00199]
    1584 (CYP11B1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.4  steroid 11beta-monooxygenase
     1584 (CYP11B1)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP11 family
   1584 (CYP11B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 1584
NCBI-ProteinID: NP_000488
OMIM: 610613
HGNC: 2591
Ensembl: ENSG00000160882
Vega: OTTHUMG00000164637
Pharos: P15538(Tclin)
UniProt: P15538 Q8TDD0
Position
8q24.3
AA seq 503 aa AA seqDB search
MALRAKAEVCMAVPWLSLQRAQALGTRAARVPRTVLPFEAMPRRPGNRWLRLLQIWREQG
YEDLHLEVHQTFQELGPIFRYDLGGAGMVCVMLPEDVEKLQQVDSLHPHRMSLEPWVAYR
QHRGHKCGVFLLNGPEWRFNRLRLNPEVLSPNAVQRFLPMVDAVARDFSQALKKKVLQNA
RGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFM
PRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFSRPQQYTSIVAELLLNAELS
PDAIKANSMELTAGSVDTTVFPLLMTLFELARNPNVQQALRQESLAAAASISEHPQKATT
ELPLLRAALKETLRLYPVGLFLERVASSDLVLQNYHIPAGTLVRVFLYSLGRNPALFPRP
ERYNPQRWLDIRGSGRNFYHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHLQVETLTQED
IKMVYSFILRPSMFPLLTFRAIN
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggcactcagggcaaaggcagaggtgtgcatggcagtgccctggctgtccctgcaaagg
gcacaggcactgggcacgagagccgcccgggtccccaggacagtgctgccctttgaagcc
atgccccggcgtccaggcaacaggtggctgaggctgctgcagatctggagggagcagggt
tatgaggacctgcacctggaagtacaccagaccttccaggaactagggcccattttcagg
tacgacttgggaggagcaggcatggtgtgtgtgatgctgccggaggacgtggagaagctg
caacaggtggacagcctgcatccccacaggatgagcctggagccctgggtggcctacaga
caacatcgtgggcacaaatgtggcgtgttcttgctgaatgggcctgaatggcgcttcaac
cgattgcggctgaatccagaagtgctgtcgcccaacgctgtgcagaggttcctcccgatg
gtggatgcagtggccagggacttctcccaggccctgaagaagaaggtgctgcagaacgcc
cgggggagcctgaccctggacgtccagcccagcatcttccactacaccatagaagccagc
aacttggctctttttggagagcggctgggcctggttggccacagccccagttctgccagc
ctgaacttcctccatgccctggaggtcatgttcaaatccaccgtccagctcatgttcatg
cccaggagcctgtctcgctggaccagccccaaggtgtggaaggagcactttgaggcctgg
gactgcatcttccagtacggcgacaactgtatccagaaaatctatcaggaactggccttc
agccgccctcaacagtacaccagcatcgtggcggagctcctgttgaatgcggaactgtcg
ccagatgccatcaaggccaactctatggaactcactgcagggagcgtggacacgacggtg
tttcccttgctgatgacgctctttgagctggctcggaaccccaacgtgcagcaggccctg
cgccaggagagcctggccgccgcagccagcatcagtgaacatccccagaaggcaaccacc
gagctgcccttgctgcgtgcggccctcaaggagaccttgcggctctaccctgtgggtctg
tttctggagcgagtggcgagctcagacttggtgcttcagaactaccacatcccagctggg
acattggtgcgcgtgttcctctactctctgggtcgcaaccccgccttgttcccgaggcct
gagcgctataacccccagcgctggctagacatcaggggctccggcaggaacttctaccac
gtgccctttggctttggcatgcgccagtgccttgggcggcgcctggcagaggcagagatg
ctgctgctgctgcaccatgtgctgaaacacctccaggtggagacactaacccaagaggac
ataaagatggtctacagcttcatattgaggcccagcatgttccccctcctcaccttcaga
gccatcaactaa

DBGET integrated database retrieval system