KEGG   Homo sapiens (human): 158427Help
Entry
158427            CDS       T01001                                 

Gene name
TSTD2, C9orf97
Definition
(RefSeq) thiosulfate sulfurtransferase like domain containing 2
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Rhodanese_C UPF0176_N Rhodanese
Motif
Other DBs
NCBI-GeneID: 158427
NCBI-ProteinID: NP_640339
HGNC: 30087
Ensembl: ENSG00000136925
Vega: OTTHUMG00000020328
Pharos: Q5T7W7(Tdark)
UniProt: Q5T7W7
Position
9q22.33
AA seq 516 aa AA seqDB search
MPSSTSPDQGDDLENCILRFSDLDLKDMSLINPSSSLKAELDGSTKKKYSFAKKKAFALF
VKTKEVPTKRSFECKEKLWKCCRQLFTDQTSIHRHVATQHADEIYHQTASILKQLAVTLS
TSKSLSSADEKNPLKECLPHSHDVSAWLPDISCFNPDELISGQGSEEGEVLLYYCYHDLE
DPQWICAWQTALCQHLHLTGKIRIAAEGINGTVGGSKLATRLYVEVMLSFPLFKDDLCKD
DFKTSKGGAHCFPELRVGVFEEIVPMGISPKKISYKKPGIHLSPGEFHKEVEKFLSQANQ
EQSDTILLDCRNFYESKIGRFQGCLAPDIRKFSYFPSYVDKNLELFREKRVLMYCTGGIR
CERGSAYLKAKGVCKEVFQLKGGIHKYLEEFPDGFYKGKLFVFDERYALSYNSDVVSECS
YCGARWDQYKLCSTPQCRQLVLTCPACQGQGFTACCVTCQDKGSRKVSGPMQDSFKEECE
CTARRPRIPRELLQHVRQPVSPEPGPDADEDGPVLM
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgccttcttccacttcaccagaccaaggagatgacctggagaactgcattttaagattt
tctgacctggatttaaaagatatgagtcttattaatcccagcagcagtcttaaagcagaa
ttagatggcagtacaaaaaagaaatactcgtttgcaaagaaaaaggcctttgcccttttt
gtcaaaaccaaagaagttccaacaaaaaggagttttgaatgtaaagaaaaattgtggaaa
tgctgtcggcagctattcacagaccaaaccagcatccatagacatgtggcaacacaacat
gctgatgaaatttatcaccagacagcttctattttaaagcaactggctgtgacattgagc
acctcaaagagtctttcgtctgcagatgaaaagaaccctttaaaagagtgccttccacat
agccatgacgtgtctgcttggctccctgatataagctgctttaaccctgatgagctgata
agtggccagggcagtgaagaaggggaggtgctcctttattactgctaccatgacctggag
gatccccaatggatctgtgcctggcagacagctctgtgtcagcacctgcacctcacaggc
aagattcgaattgctgcagaaggaatcaatgggacagttggtggaagcaaattggctacc
agactttatgtggaagtcatgctttccttcccattgtttaaggatgacctgtgtaaagat
gattttaagaccagcaaaggaggagctcactgttttccagaattgcgtgttggtgtattt
gaagaaatcgtgcccatggggatcagccccaaaaagatctcctacaagaagcctggaatc
catttatccccaggtgaatttcataaagaagtagaaaagtttttatctcaggcaaatcaa
gaacaaagtgatactatccttcttgattgcagaaacttctatgaaagcaaaataggacga
ttccaaggctgcttagccccagacatcaggaaattcagttacttccctagctacgttgac
aaaaatctagaacttttcagagagaagagagtgctgatgtactgtaccgggggcatccgc
tgtgagcggggttcagcctacctcaaagccaagggagtgtgcaaggaggtgttccagctc
aagggtggcatccacaagtacctggaagagtttcctgatggcttttacaaagggaagttg
tttgtttttgatgaacgctatgctctgtcctacaacagtgatgtggtgtcagagtgttca
tactgtggagcccgctgggaccagtataaactctgctctactccccagtgccgccagctc
gttttgacctgccctgcctgtcaaggacaaggattcacagcctgttgtgtcacatgtcaa
gacaaggggagcaggaaagtttcaggccctatgcaagacagctttaaagaggaatgcgag
tgcacagcccgacggccacgcatacctagggaactcttgcagcatgtgcgacagcctgtg
agcccagagccagggcctgatgctgatgaggatgggccagtgcttatgtga

DBGET integrated database retrieval system