KEGG   Homo sapiens (human): 1585Help
Entry
1585              CDS       T01001                                 

Gene name
CYP11B2, ALDOS, CPN2, CYP11B, CYP11BL, CYPXIB2, P-450C18, P450C18, P450aldo
Definition
(RefSeq) cytochrome P450 family 11 subfamily B member 2
  KO
K07433  steroid 11beta-monooxygenase / corticosterone 18-monooxygenase [EC:1.14.15.4 1.14.15.5]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00140  Steroid hormone biosynthesis
hsa01100  Metabolic pathways
hsa04925  Aldosterone synthesis and secretion
Module
hsa_M00108  C21-Steroid hormone biosynthesis, progesterone => corticosterone/aldosterone
hsa_M00109  C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
Network
nt06019  Steroid hormone biosynthesis
nt06310  CRH-ACTH-cortisol signaling
nt06316  Angiotensin-aldosterone signaling
  Element
N00298  CYP11B1-CYP11B2 fusion to ACTH-cortisol signaling pathway
N00301  Angiotensin-aldosterone signaling pathway
N00302  Mutation-activated CACNA1D/H to angiotensin-aldosterone signaling pathway
N00303  Mutation-activated KCNJ5 to angiotensin-aldosterone signaling pathway
N00304  Mutation-inactivated ATP1A1 to angiotensin-aldosterone signaling pathway
N00305  Mutation-inactivated ATP2B3 to angiotensin-aldosterone signaling pathway
N00338  Steroid hormone biosynthesis, progesterone to cortisol/cortisone
N00339  Steroid hormone biosynthesis, progesterone to aldosterone
N00761  CYP21A2 deficiency in steroid hormone biosynthesis
N00762  CYP17A1 deficiency in steroid hormone biosynthesis
N00773  HSD11B2 deficiency in steroid hormone biosynthesis
N00774  CYP11B2 deficiency in steroid hormone biosynthesis
Disease
H00258  Aldosterone synthase deficiency
H00602  Glucocorticoid-remediable aldosteronism (GRA)
H01633  High blood pressure
Drug target
Osilodrostat (DG02839): D11061
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    1585 (CYP11B2)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    1585 (CYP11B2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:hsa00199]
    1585 (CYP11B2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.4  steroid 11beta-monooxygenase
     1585 (CYP11B2)
    1.14.15.5  corticosterone 18-monooxygenase
     1585 (CYP11B2)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP11 family
   1585 (CYP11B2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 1585
NCBI-ProteinID: NP_000489
OMIM: 124080
HGNC: 2592
Ensembl: ENSG00000179142
Vega: OTTHUMG00000160254
Pharos: P19099(Tchem)
UniProt: P19099
Structure
PDB: 

Position
8q24.3
AA seq 503 aa AA seqDB search
MALRAKAEVCVAAPWLSLQRARALGTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQG
YEHLHLEMHQTFQELGPIFRYNLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAYR
QHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNA
RGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFM
PRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFNRPQHYTGIVAELLLKAELS
LEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQILRQESLAAAASISEHPQKATT
ELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNAALFPRP
ERYNPQRWLDIRGSGRNFHHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQED
IKMVYSFILRPGTSPLLTFRAIN
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggcactcagggcaaaggcagaggtgtgcgtggcagcgccctggctgtccctgcaaagg
gcacgggcactgggcactagagccgctcgggcccctaggacggtgctgccgtttgaagcc
atgccccagcatccaggcaacaggtggctgaggctgctgcagatctggagggagcagggt
tatgagcacctgcacctggagatgcaccagaccttccaggagctggggcccattttcagg
tacaacttgggaggaccacgcatggtgtgtgtgatgctgccggaggatgtggagaagctg
caacaggtggacagcctgcatccctgcaggatgatcctggagccctgggtggcctacaga
caacatcgtgggcacaaatgtggcgtgttcttgttgaatgggcctgaatggcgcttcaac
cgattgcggctgaacccagatgtgctgtcgcccaaggccgtgcagaggttcctcccgatg
gtggatgcagtggccagggacttctcccaggccctgaagaagaaggtgctgcagaacgcc
cgggggagcctgaccctggacgtccagcccagcatcttccactacaccatagaagccagc
aacttagctctttttggagagcggctgggcctggttggccacagccccagttctgccagc
ctgaacttcctccatgccctggaggtcatgttcaaatccaccgtccagctcatgttcatg
cccaggagcctgtctcgctggatcagccccaaggtgtggaaggagcactttgaggcctgg
gactgcatcttccagtacggtgacaactgtatccagaaaatctaccaggaactggccttc
aaccgccctcaacactacacaggcatcgtggcggagctcctgttgaaggcggaactgtca
ctagaagccatcaaggccaactctatggaactcactgcagggagcgtggacacgacagcg
tttcccttgctgatgacgctctttgagctggctcggaaccccgacgtgcagcagatcctg
cgccaggagagcctggccgccgcagccagcatcagtgaacatccccagaaggcaaccacc
gagctgcccttgctgcgggcggccctcaaggagaccttgcggctctaccctgtgggtctg
tttttggagcgagtggtgagctcagacttggtgcttcagaactaccacatcccagctggg
acattggtacaggttttcctctactcgctgggtcgcaatgccgccttgttcccgaggcct
gagcggtataatccccagcgctggctagacatcaggggctccggcaggaacttccaccac
gtgccctttggctttggcatgcgccagtgcctcgggcggcgcctggcagaggcagagatg
ctgctgctgctgcaccacgtgctgaagcacttcctggtggagacactaactcaagaggac
ataaagatggtctacagcttcatattgaggcctggcacgtcccccctcctcactttcaga
gcgattaactag

DBGET integrated database retrieval system