KEGG   Homo sapiens (human): 158584Help
Entry
158584            CDS       T01001                                 

Gene name
FAAH2, AMDD
Definition
(RefSeq) fatty acid amide hydrolase 2
  KO
K19176  fatty acid amide hydrolase 2 [EC:3.5.1.99]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    158584 (FAAH2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.99  fatty acid amide hydrolase
     158584 (FAAH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-GeneID: 158584
NCBI-ProteinID: NP_777572
OMIM: 300654
HGNC: 26440
Ensembl: ENSG00000165591
Vega: OTTHUMG00000021684
Pharos: Q6GMR7(Tchem)
UniProt: Q6GMR7 B2C6G4
Position
Xp11.21
AA seq 532 aa AA seqDB search
MAPSFTARIQLFLLRALGFLIGLVGRAALVLGGPKFASKTPRPVTEPLLLLSGMQLAKLI
RQRKVKCIDVVQAYINRIKDVNPMINGIVKYRFEEAMKEAHAVDQKLAEKQEDEATLENK
WPFLGVPLTVKEAFQLQGMPNSSGLMNRRDAIAKTDATVVALLKGAGAIPLGITNCSELC
MWYESSNKIYGRSNNPYDLQHIVGGSSGGEGCTLAAACSVIGVGSDIGGSIRMPAFFNGI
FGHKPSPGVVPNKGQFPLAVGAQELFLCTGPMCRYAEDLAPMLKVMAGPGIKRLKLDTKV
HLKDLKFYWMEHDGGSFLMSKVDQDLIMTQKKVVVHLETILGASVQHVKLKKMKYSFQLW
IAMMSAKGHDGKEPVKFVDLLGDHGKHVSPLWELIKWCLGLSVYTIPSIGLALLEEKLRY
SNEKYQKFKAVEESLRKELVDMLGDDGVFLYPSHPTVAPKHHVPLTRPFNFAYTGVFSAL
GLPVTQCPLGLNAKGLPLGIQVVAGPFNDHLTLAVAQYLEKTFGGWVCPGKF
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggcaccttcatttaccgcccgcattcagttgttcctcttgcgggcgctaggctttctc
ataggcttagtaggccgagcagctttagtcttagggggtccaaagtttgcctcaaagacc
cctcggccggtgactgaaccattgcttctgctttcggggatgcagctggccaagctgatc
cgacagagaaaggtgaaatgtatagatgttgttcaggcttatatcaacagaatcaaggac
gtgaacccaatgatcaatggaattgtcaagtacaggtttgaggaagcgatgaaggaggct
catgctgtagatcaaaagcttgcagagaagcaggaagatgaagccaccctggaaaataaa
tggcccttccttggggttcctttgacagtcaaggaagctttccagctacaaggaatgccc
aattcttctggactcatgaaccgtcgtgatgccattgccaaaacagatgccactgtggtg
gcattactgaagggagctggtgccattcctcttggcataaccaactgtagtgagttgtgt
atgtggtatgaatccagtaacaagatctatggccgatcaaacaacccatatgatttacag
catattgtaggtggaagttctggtggtgagggctgcacactggcagctgcctgctcagtt
attggtgtgggctctgatattggtggtagcattcgaatgcctgctttcttcaatggtata
tttggacacaagccttctccaggtgtggttcccaacaaaggtcagtttcccttggctgtg
ggagcccaggagttgtttctgtgcactggtcctatgtgccgttatgctgaagacctggcc
cccatgttgaaggtcatggcaggacctgggatcaaaaggttaaaactagacacaaaggta
catttaaaagacttaaaattttactggatggaacatgatggaggctcatttttaatgtcc
aaagtggaccaagatctcattatgactcagaaaaaggttgtggttcaccttgaaactatt
ctaggagcctcagttcaacatgttaaactgaagaaaatgaagtactcttttcagttgtgg
atcgcaatgatgtcagcaaagggacatgatgggaaggaacctgtgaaatttgtagatttg
cttggtgaccatgggaaacatgtcagtcctctgtgggagttgatcaaatggtgcctgggt
ctgtcagtgtacaccatcccttccattggactggctttgttggaagaaaagctcagatat
agcaatgagaaataccaaaagtttaaggcagtggaagaaagcctgcgtaaagagctggtg
gatatgctaggtgatgatggtgtgttcttatatccctcacatcccacagtggcacctaag
catcatgtccctctaacacggcctttcaactttgcttacacaggtgtcttcagtgccctg
ggtttgcctgtgacccaatgcccactgggactgaatgccaaaggactccctttaggcatc
caggttgtggctggaccctttaatgatcatctgaccctggctgtggcccagtacttggag
aaaacttttgggggctgggtctgtccaggaaagttttag

DBGET integrated database retrieval system