KEGG   Homo sapiens (human): 1586Help
Entry
1586              CDS       T01001                                 

Gene name
CYP17A1, CPT7, CYP17, P450C17, S17AH
Definition
(RefSeq) cytochrome P450 family 17 subfamily A member 1
  KO
K00512  steroid 17alpha-monooxygenase / 17alpha-hydroxyprogesterone deacetylase [EC:1.14.14.19 1.14.14.32]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00140  Steroid hormone biosynthesis
hsa01100  Metabolic pathways
hsa04913  Ovarian steroidogenesis
hsa04917  Prolactin signaling pathway
hsa04927  Cortisol synthesis and secretion
hsa04934  Cushing syndrome
Module
hsa_M00109  C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
hsa_M00110  C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone
Network
N00306  SF-1-mediated transcription
N00307  Mutation-inactivated DAX1 to SF-1-mediated transcription
N00308  Mutation-inactivated SF-1 to transcription
N00338  Cortisol biosynthesis
Disease
H00216  Congenital adrenal hyperplasia (CAH)
H00608  46,XY disorders of sex development (Disorders in androgen synthesis or action)
Drug target
Abiraterone: D09701
Galeterone: D10125
Mitotane: D00420
Orteronel: D10146
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    1586 (CYP17A1)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian Steroidogenesis
    1586 (CYP17A1)
   04917 Prolactin signaling pathway
    1586 (CYP17A1)
   04927 Cortisol synthesis and secretion
    1586 (CYP17A1)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04934 Cushing syndrome
    1586 (CYP17A1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:hsa00199]
    1586 (CYP17A1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.19  steroid 17alpha-monooxygenase
     1586 (CYP17A1)
    1.14.14.32  17alpha-hydroxyprogesterone deacetylase
     1586 (CYP17A1)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP17 family
   1586 (CYP17A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 1586
NCBI-ProteinID: NP_000093
OMIM: 609300
HGNC: 2593
Ensembl: ENSG00000148795
Vega: OTTHUMG00000018969
Pharos: P05093(Tclin)
UniProt: P05093 Q1HB44
Structure
PDB: 

Position
10q24.32
AA seq 508 aa AA seqDB search
MWELVALLLLTLAYLFWPKRRCPGAKYPKSLLSLPLVGSLPFLPRHGHMHNNFFKLQKKY
GPIYSVRMGTKTTVIVGHHQLAKEVLIKKGKDFSGRPQMATLDIASNNRKGIAFADSGAH
WQLHRRLAMATFALFKDGDQKLEKIICQEISTLCDMLATHNGQSIDISFPVFVAVTNVIS
LICFNTSYKNGDPELNVIQNYNEGIIDNLSKDSLVDLVPWLKIFPNKTLEKLKSHVKIRN
DLLNKILENYKEKFRSDSITNMLDTLMQAKMNSDNGNAGPDQDSELLSDNHILTTIGDIF
GAGVETTTSVVKWTLAFLLHNPQVKKKLYEEIDQNVGFSRTPTISDRNRLLLLEATIREV
LRLRPVAPMLIPHKANVDSSIGEFAVDKGTEVIINLWALHHNEKEWHQPDQFMPERFLNP
AGTQLISPSVSYLPFGAGPRSCIGEILARQELFLIMAWLLQRFDLEVPDDGQLPSLEGIP
KVVFLIDSFKVKIKVRQAWREAQAEGST
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgtgggagctcgtggctctcttgctgcttaccctagcttatttgttttggcccaagaga
aggtgccctggtgccaagtaccccaagagcctcctgtccctgcccctggtgggcagcctg
ccattcctccccagacacggccatatgcataacaacttcttcaagctgcagaaaaaatat
ggccccatctattcggttcgtatgggcaccaagactacagtgattgtcggccaccaccag
ctggccaaggaggtgcttattaagaagggcaaggacttctctgggcggcctcaaatggca
actctagacatcgcgtccaacaaccgtaagggtatcgccttcgctgactctggcgcacac
tggcagctgcatcgaaggctggcgatggccacctttgccctgttcaaggatggcgatcag
aagctggagaagatcatttgtcaggaaatcagtacattgtgtgatatgctggccacccac
aacggacagtccatagacatctcctttcctgtcttcgtggcggtaaccaatgtcatctcc
ttgatctgcttcaatacctcctacaagaatggggaccctgagttgaatgtcatacagaat
tacaatgaaggcatcatagacaacctgagcaaagacagcctggtggacctagtcccctgg
ttgaagattttccccaacaaaaccctggaaaaattaaagagccatgttaaaatacgaaat
gatctgctgaataaaatacttgaaaattacaaggagaaattccggagtgactctatcacc
aacatgctggacacactgatgcaagccaagatgaactcagataatggcaatgctggccca
gatcaagactcagagctgctttcagataaccacattctcaccaccataggggacatcttt
ggggctggcgtggagaccaccacctctgtggttaaatggaccctggccttcctgctgcac
aatcctcaggtgaagaagaagctctacgaggagattgaccagaatgtgggtttcagccgc
acaccaactatcagtgaccgtaaccgtctcctcctgctggaggccaccatccgagaggtg
cttcgcctcaggcccgtggcccctatgctcatcccccacaaggccaacgttgactccagc
atcggtgagtttgctgtggacaagggcacagaagttatcatcaatctgtgggcgctgcat
cacaatgagaaggagtggcaccagccggatcagttcatgcctgagcgtttcttgaatcca
gcggggacccagctcatctcaccgtcagtaagctatttgcccttcggagcaggacctcgc
tcctgtataggtgagatcctggcccgccaggagctcttcctcatcatggcctggctgctg
cagaggttcgacctggaggtgccagatgatgggcagctgccctccctggaaggcatcccc
aaggtggtctttctgatcgactctttcaaagtgaagatcaaggtgcgccaggcctggagg
gaagcccaggctgagggtagcacctaa

DBGET integrated database retrieval system