KEGG   Homo sapiens (human): 158747Help
Entry
158747            CDS       T01001                                 

Gene name
MOSPD2
Definition
(RefSeq) motile sperm domain containing 2
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: CRAL_TRIO Motile_Sperm CRAL_TRIO_2 PapD-like
Motif
Other DBs
NCBI-GeneID: 158747
NCBI-ProteinID: NP_689794
HGNC: 28381
Ensembl: ENSG00000130150
Vega: OTTHUMG00000021170
Pharos: Q8NHP6(Tdark)
UniProt: Q8NHP6
Position
Xp22.2
AA seq 518 aa AA seqDB search
MAENHAQNKAKLISETRRRFEAEYVTDKSDKYDARDVERLQQDDNWVESYLSWRHNIVDE
TLKMLDESFQWRKEISVNDLNESSIPRWLLEIGVIYLHGYDKEGNKLFWIRVKYHVKDQK
TILDKKKLIAFWLERYAKRENGKPVTVMFDLSETGINSIDMDFVRFIINCFKVYYPKYLS
KIVIFDMPWLMNAAFKIVKTWLGPEAVSLLKFTSKNEVQDYVSVEYLPPHMGGTDPFKYS
YPPLVDDDFQTPLCENGPITSEDETSSKEDIESDGKETLETISNEEQTPLLKKINPTEST
SKAEENEKVDSKVKAFKKPLSVFKGPLLHISPAEELYFGSTESGEKKTLIVLTNVTKNIV
AFKVRTTAPEKYRVKPSNSSCDPGASVDIVVSPHGGLTVSAQDRFLIMAAEMEQSSGTGP
AELTQFWKEVPRNKVMEHRLRCHTVESSKPNTLTLKDNAFNMSDKTSEDICLQLSRLLES
NRKLEDQVQRCIWFQQLLLSLTMLLLAFVTSFFYLLYS
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaatcacgcccagaataaagccaagctcatctctgagacccggaggaggttc
gaagctgagtatgtgacagataagtcagataaatatgatgcacgtgatgttgaaaggcta
caacaagatgataactgggttgaaagttacttatcttggagacataatattgtagatgaa
acactgaagatgctcgatgagagttttcagtggaggaaagaaatttctgtcaatgacctt
aatgaatcctccattcccagatggttattggaaattggtgttatttatctccatggttat
gacaaagaaggtaacaaattgttctggatcagggtgaagtatcatgtaaaagaccagaaa
accatattggacaaaaagaagctcatagcattctggttggaacgttatgctaagagggaa
aatgggaaacctgtaacagtgatgtttgacctgtcagaaactggaataaatagcattgac
atggactttgtacgctttatcatcaactgctttaaggtttattaccctaaatacctctca
aaaatagtgatctttgatatgccttggttaatgaatgctgctttcaaaattgtgaaaacc
tggcttggtccagaagcagtgagcttgttgaagtttacaagcaaaaatgaagtccaggac
tatgtcagtgtagaatacctgcctccccacatgggtggaactgatcctttcaagtatagc
tatccaccactagtagatgatgacttccagaccccactgtgtgagaatgggcctattacc
agtgaggatgaaacttcaagtaaagaagacatagaaagtgatggcaaagaaacattggaa
acaatttctaatgaagaacaaacacctcttcttaaaaagattaacccaaccgaatctact
tccaaagcagaagaaaatgaaaaagttgattcaaaagtgaaagctttcaagaaaccattg
agtgtatttaaaggccccttactacacatcagcccagcagaagaactgtactttggaagt
acagaatccggagagaagaaaaccttaatagtgttgacaaatgtaactaaaaatatagtg
gcatttaaggtgagaacaacagctccagaaaaatacagagtcaagccaagcaatagcagc
tgtgacccgggtgcatcagtggatatagttgtgtctccccatgggggtttaacagtctct
gcccaagaccgttttctgataatggctgcagaaatggaacagtcatctggcacaggccca
gcagaattaactcagttttggaaagaagttcccagaaacaaagtgatggaacataggtta
agatgccatactgttgaaagcagtaaaccaaacactcttacgttaaaagacaatgctttc
aatatgtcagataaaaccagtgaagatatatgtctacaactcagtcgtttactagaaagc
aataggaagcttgaagaccaagttcagcgttgtatctggttccagcagctgctgctttcc
ttaacaatgctcttgcttgcttttgtcacctctttcttctatttattgtacagttaa

DBGET integrated database retrieval system