KEGG   Homo sapiens (human): 158787
Entry
158787            CDS       T01001                                 

Gene name
RIBC1, 2610028I09Rik
Definition
(RefSeq) RIB43A domain with coiled-coils 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: RIB43A
Other DBs
NCBI-GeneID: 158787
NCBI-ProteinID: NP_001026915
HGNC: 26537
Ensembl: ENSG00000158423
Vega: OTTHUMG00000021615
Pharos: Q8N443(Tdark)
UniProt: Q8N443 A0A024R9X7
Position
Xp11.22
AA seq 379 aa
MYNIKQSTDTKEAAAIEARRNREKERQNRFFNVRNRVMGVDVQALNNQVGDRKRREAAER
SKEAAYGTSQVQYDVVVQMLEKEEADRTRQLAKKVQEFREQKQQLKNGREFSLWDPGQVW
KGLPTYLSYSNTYPGPASLQYFSGEDLDRDTRLRMQQGQFRYNLERQQQEQQQAKVDENY
TDALSNQLRLAMDAQATHLARLEESCRAAMMCAMANANKAQAAVQAGRQRCERQREQKAN
LAEIQHQSTSDLLTENPQVAQHPMAPYRVLPYCWKGMTPEQQAAIRKEQEVQRSKKQAHR
QAEKTLDTEWKSQTMSSAQAVLELEEQERELCAVFQRGLGSFNQQLANEQKAQQDYLNSV
IYTNQPTAQYHQQFNTSSR
NT seq 1140 nt   +upstreamnt  +downstreamnt
atgtataacataaaacagtcaacagataccaaggaagcagcagccatcgaggctagaaga
aatcgagaaaaagagcgacaaaaccgattcttcaatgtgcggaaccgagtcatgggggtg
gatgtccaggccctgaacaaccaggtgggagaccgaaagcgtcgggaagcagcagaaaga
agcaaggaggcagcttatggtaccagccaggtgcagtatgatgtggtagtccagatgtta
gagaaggaagaggcagatcgaacacgtcagctggccaagaaagtccaggagtttcgggag
cagaagcagcagctcaagaacgggcgtgaatttagtctttgggatccaggccaagtctgg
aaggggcttccaacctatcttagttacagtaatacctatcctggtccagccagcctgcag
tacttctctggggaagacctagacagggacacacggctgagaatgcagcaggggcagttc
aggtacaacttggaaaggcaacagcaggagcaacagcaagccaaggttgatgagaattat
acagatgcgctcagtaaccagctgcgcctcgccatggatgcacaggccacccatctggcc
aggctggaggagtcctgtcgtgcggccatgatgtgtgccatggccaacgccaacaaagcg
caggcagctgtgcaggctgggcgtcagcgctgtgagcgtcagcgtgaacagaaggccaac
cttgcggagatccagcaccagagcacgagtgacctactgactgaaaacccccaggtcgcc
caacaccctatggctccctaccgggtcctgccctattgctggaagggcatgactccagag
cagcaagctgccatcaggaaagagcaggaagtacaacgctctaagaagcaagcacaccgt
caggctgagaaaacactggatactgaatggaaaagccagaccatgagctcagcccaggca
gtgctggagctagaagagcaggagagggaattgtgtgctgtatttcaaaggggtctagga
tccttcaaccagcagctggctaatgagcaaaaagcccagcaggattacctgaattcagta
atctacaccaatcaacctacagcccagtatcaccagcagtttaacaccagcagccgctaa

DBGET integrated database retrieval system