KEGG   Homo sapiens (human): 158866Help
Entry
158866            CDS       T01001                                 

Gene name
ZDHHC15, DHHC15, MRX91
Definition
(RefSeq) zinc finger DHHC-type palmitoyltransferase 15
  KO
K20028  palmitoyltransferase ZDHHC2/15/20 [EC:2.3.1.225]
Organism
hsa  Homo sapiens (human)
Disease
H00480  X-linked mental retardation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    158866 (ZDHHC15)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     158866 (ZDHHC15)
Membrane trafficking [BR:hsa04131]
 SNARE
  SNARE associated proteins
   Palmitoyltransferases
    158866 (ZDHHC15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC
Motif
Other DBs
NCBI-GeneID: 158866
NCBI-ProteinID: NP_659406
OMIM: 300576
HGNC: 20342
Ensembl: ENSG00000102383
Vega: OTTHUMG00000021866
Pharos: Q96MV8(Tdark)
UniProt: Q96MV8 B3KY34
Position
Xq13.3
AA seq 337 aa AA seqDB search
MRRGWKMALSGGLRCCRRVLSWVPVLVIVLVVLWSYYAYVFELCLVTVLSPAEKVIYLIL
YHAIFVFFTWTYWKSIFTLPQQPNQKFHLSYTDKERYENEERPEVQKQMLVDMAKKLPVY
TRTGSGAVRFCDRCHLIKPDRCHHCSVCAMCVLKMDHHCPWVNNCIGFSNYKFFLQFLAY
SVLYCLYIATTVFSYFIKYWRGELPSVRSKFHVLFLLFVACMFFVSLVILFGYHCWLVSR
NKTTLEAFCTPVFTSGPEKNGFNLGFIKNIQQVFGDKKKFWLIPIGSSPGDGHSFPMRSM
NESQNPLLANEETWEDNEDDNQDYPEGSSSLAVETET
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgcggcgaggctggaagatggctctgtctggggggctgcggtgctgccgccgggtactg
tcctgggtgccagtgctcgttattgtcctcgtcgtgctctggtcctactatgcctacgtc
tttgaactctgcctggtgactgttttgagcccagcagaaaaagttatttacctcatactc
taccatgccatctttgtgttctttacctggacctactggaagtctatctttacactccca
cagcagccaaaccagaagttccacttgtcctacacagacaaggagcgctatgaaaatgaa
gaaagacctgaggtccagaagcagatgcttgttgatatggccaaaaagctaccggtttac
acaagaactggaagtggagctgtacgattctgtgaccggtgtcatctgatcaagccagac
cgctgccaccactgctctgtctgtgctatgtgtgtgttaaaaatggatcatcactgccct
tgggttaataactgcattggattttccaactacaaattcttccttcaattcttagcttac
tctgttctctactgcctgtacattgctacgacagtcttcagctatttcatcaaatactgg
agaggggaattacccagtgttcgctctaagttccatgtcctttttcttctctttgtggcc
tgcatgttttttgtcagccttgtgattctctttggttaccattgttggcttgtcagcaga
aacaaaaccaccttagaggccttctgcactccagtgtttacaagtggcccagagaaaaat
gggttcaaccttggcttcatcaagaatatccagcaggtgtttggagataagaagaagttc
tggttaatacctattggttccagccctggtgatggacactccttccctatgaggtctatg
aatgagtcacagaacccactgctagcaaatgaagaaacctgggaagacaacgaggatgac
aaccaagattatccagaaggctcatcatctcttgctgtggaaacggaaacatag

DBGET integrated database retrieval system