KEGG   Homo sapiens (human): 159Help
Entry
159               CDS       T01001                                 

Gene name
ADSS, ADEH, ADSS_2
Definition
(RefSeq) adenylosuccinate synthase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa00250  Alanine, aspartate and glutamate metabolism
hsa01100  Metabolic pathways
Module
hsa_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    159 (ADSS)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    159 (ADSS)
Enzymes [BR:hsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     159 (ADSS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Adenylsucc_synt Spore_YpjB
Motif
Other DBs
NCBI-GeneID: 159
NCBI-ProteinID: NP_001117
OMIM: 103060
HGNC: 292
Ensembl: ENSG00000035687
Vega: OTTHUMG00000040102
Pharos: P30520(Tchem)
UniProt: P30520 A0A024R5Q7
Structure
PDB: 

Position
1q44
AA seq 456 aa AA seqDB search
MAFAETYPAASSLPNGDCGRPRARPGGNRVTVVLGAQWGDEGKGKVVDLLAQDADIVCRC
QGGNNAGHTVVVDSVEYDFHLLPSGIINPNVTAFIGNGVVIHLPGLFEEAEKNVQKGKGL
EGWEKRLIISDRAHIVFDFHQAADGIQEQQRQEQAGKNLGTTKKGIGPVYSSKAARSGLR
MCDLVSDFDGFSERFKVLANQYKSIYPTLEIDIEGELQKLKGYMEKIKPMVRDGVYFLYE
ALHGPPKKILVEGANAALLDIDFGTYPFVTSSNCTVGGVCTGLGMPPQNVGEVYGVVKAY
TTRVGIGAFPTEQDNEIGELLQTRGREFGVTTGRKRRCGWLDLVLLKYAHMINGFTALAL
TKLDILDMFTEIKVGVAYKLDGEIIPHIPANQEVLNKVEVQYKTLPGWNTDISNARAFKE
LPVNAQNYVRFIEDELQIPVKWIGVGKSRESMIQLF
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcgccgagacctacccggcggcatcctccctgcccaacggcgattgcggccgc
cccagggcgcggcccggaggaaaccgggtgacggtggtgctcggtgcgcagtggggcgac
gaaggcaaagggaaggtggtggacctgctggcgcaggacgccgacatcgtgtgccgctgc
cagggaggaaataatgctggccatacagttgttgtggattctgtggaatatgattttcat
ctcttacccagtggaataattaatccaaatgtcactgcattcattggaaatggtgtggta
attcatctacctggattgtttgaagaagcagagaaaaatgttcaaaaaggaaaaggacta
gaaggctgggaaaaaaggcttattatatctgacagagctcatattgtatttgattttcat
caagcagctgatggtatccaggaacaacagagacaagaacaagcaggaaaaaatttgggt
acaacaaaaaagggcattggcccagtttattcgtccaaagctgctcggagtggactcagg
atgtgcgaccttgtttctgactttgatggcttctctgagaggtttaaagttctagctaac
caatacaaatctatataccccactttggaaatagacattgaaggtgaattacaaaaactc
aagggttatatggaaaagattaaaccaatggtgagagatggagtttattttctatatgag
gccctacatggaccaccaaagaaaatcttggtagaaggtgcaaatgcagcactattagat
attgattttgggacttacccttttgtaacctcttcaaattgtactgttggaggtgtttgt
actggtttgggtatgccacctcaaaatgttggagaagtgtatggagttgtgaaagcttat
acaactagagttggtattggtgcctttcctacagagcaagacaatgaaattggagaatta
ttacaaacaaggggtagagagtttggtgtaactactggaaggaaaagaagatgtggctgg
ttggacctcgttttgctcaaatatgctcatatgatcaatggatttactgcgttggcactt
accaagttggatattttggacatgtttacggaaatcaaagttggagttgcttacaagtta
gatggtgaaatcatacctcatatcccagcaaaccaagaagtcttaaataaagttgaagtt
caatataagactctcccaggatggaacacagacatatcaaatgcaagggcgtttaaagaa
ctacctgttaatgcacaaaactatgttcgatttattgaagatgagcttcaaattccagtt
aagtggattggtgttggtaaatccagagaatctatgattcaactcttttaa

DBGET integrated database retrieval system