KEGG   Homo sapiens (human): 1591Help
Entry
1591              CDS       T01001                                 

Gene name
CYP24A1, CP24, CYP24, HCAI, HCINF1, P450-CC24
Definition
(RefSeq) cytochrome P450 family 24 subfamily A member 1
  KO
K07436  vitamin D3 24-hydroxylase [EC:1.14.15.16]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00100  Steroid biosynthesis
hsa01100  Metabolic pathways
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa05206  MicroRNAs in cancer
Disease
H01371  Hypercalcemia infantile
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    1591 (CYP24A1)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    1591 (CYP24A1)
 09160 Human Diseases
  09161 Cancers
   05206 MicroRNAs in cancer
    1591 (CYP24A1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:hsa00199]
    1591 (CYP24A1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.16  vitamin D3 24-hydroxylase
     1591 (CYP24A1)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP24 family
   1591 (CYP24A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 1591
NCBI-ProteinID: NP_000773
OMIM: 126065
HGNC: 2602
Ensembl: ENSG00000019186
Vega: OTTHUMG00000032773
Pharos: Q07973(Tchem)
UniProt: Q07973
Position
20q13.2
AA seq 514 aa AA seqDB search
MSSPISKSRSLAAFLQQLRSPRQPPRLVTSTAYTSPQPREVPVCPLTAGGETQNAAALPG
PTSWPLLGSLLQILWKGGLKKQHDTLVEYHKKYGKIFRMKLGSFESVHLGSPCLLEALYR
TESAYPQRLEIKPWKAYRDYRKEGYGLLILEGEDWQRVRSAFQKKLMKPGEVMKLDNKIN
EVLADFMGRIDELCDERGHVEDLYSELNKWSFESICLVLYEKRFGLLQKNAGDEAVNFIM
AIKTMMSTFGRMMVTPVELHKSLNTKVWQDHTLAWDTIFKSVKACIDNRLEKYSQQPSAD
FLCDIYHQNRLSKKELYAAVTELQLAAVETTANSLMWILYNLSRNPQVQQKLLKEIQSVL
PENQVPRAEDLRNMPYLKACLKESMRLTPSVPFTTRTLDKATVLGEYALPKGTVLMLNTQ
VLGSSEDNFEDSSQFRPERWLQEKEKINPFAHLPFGVGKRMCIGRRLAELQLHLALCWIV
RKYDIQATDNEPVEMLHSGTLVPSRELPIAFCQR
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgagctcccccatcagcaagagccgctcgcttgccgccttcctgcagcagctgcgcagt
ccgaggcagcccccgagactggtgacatctacggcgtacacgtcccctcagccgcgagag
gtgccagtctgcccgctgacagctggtggcgagactcagaacgcggccgccctgccgggc
cccaccagctggccactgctgggcagcctgctgcagattctctggaaagggggtctcaag
aaacagcacgacaccctggtggagtaccacaagaagtatggcaagattttccgcatgaag
ttgggttcctttgagtcggtgcacctgggctcgccatgcctgctggaagcgctgtaccgc
accgagagcgcgtacccgcagcggctggagatcaaaccgtggaaggcctatcgcgactac
cgcaaagaaggctacgggctgctgatcctggaaggggaagactggcagcgggtccggagt
gcctttcaaaagaaactaatgaaaccaggggaagtgatgaagctggacaacaaaatcaat
gaggtcttggccgattttatgggcagaatagatgagctctgtgatgaaagaggccacgtt
gaagacttgtacagcgaactgaacaaatggtcgtttgaaagtatctgcctcgtgttgtat
gagaagagatttgggcttctccagaagaatgcaggggatgaagctgtgaacttcatcatg
gccatcaaaacaatgatgagcacgtttgggaggatgatggtcactccagtcgagctgcac
aagagcctcaacaccaaggtctggcaggaccacactctggcctgggacaccattttcaaa
tcagtcaaagcttgtatcgacaaccggttagagaagtattctcagcagcctagtgcagat
ttcctttgtgacatttatcaccagaatcggctttcaaagaaagaattgtatgctgctgtc
acagagctccagctggctgcggtggaaacgacagcaaacagtctaatgtggattctctac
aatttatcccgtaatccccaagtgcaacaaaagcttcttaaggaaattcaaagtgtatta
cctgagaatcaggtgccacgggcagaagatttgaggaatatgccgtatttaaaagcctgt
ctgaaagaatctatgaggcttacgccgagtgtaccatttacaactcggactcttgacaag
gcaacagttctgggtgaatatgctttacccaaaggaacagtgctcatgctaaatacccag
gtgttgggatccagtgaagacaattttgaagattcaagtcagtttagacctgaacgttgg
cttcaggagaaggaaaaaattaatccttttgcgcatcttccatttggcgttggaaaaaga
atgtgcattggtcgccgattagcagagcttcaactgcatttggctctttgttggattgtc
cgcaaatacgacatccaggccacagacaatgagcctgttgagatgctacactcaggcacc
ctggtgcccagccgggaactccccatcgcgttttgccagcgataa

DBGET integrated database retrieval system